(data stored in ACNUC30630 zone)

EMBL: AP009044.PE595

AP009044.PE595       Location/Qualifiers
FT   CDS_pept        616707..617657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6031"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21093"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK19"
FT                   /protein_id="BAQ21093.1"
FT                   /translation="MGDQWFKQSYQGGHIITRNSVPAVQAGIYGQIYEKWVELGSQNSA
FT                   LGFPISSEFVASDGVGRYNIFERGVMYWHPEYGAHAVTGDLLLQWAYSGGIEGVLGYPA
FT                   GDPELQDDGWYRQAFADGFLHGKQLSTFFPAWDEFAWDDSAGGEPGVLMSRQAANYDKG
FT                   PAGGNKYTDQVVLETEDMCGNEIILRRGWYNSDASRKDKPWGYDKIRHKHGVFSLWSVS
FT                   TVFENSCINRIEGTQQVYEEEVYQVKCDRLFLNCEQTGQSFVYRGIYERNIYKPGATEP
FT                   LGLRTFFPVHNEGTHGSSDVTPTWFSTDIPTLDLW"
     ttgggtgatc agtggtttaa gcaaagctat cagggcgggc acattattac ccgcaattca        60
     gttccggcag tccaagctgg tatttatggg cagatttatg aaaaatgggt ggaactagga       120
     agccaaaata gcgcccttgg atttcccatt agctcggaat tcgtagcctc tgacggagta       180
     ggacgatata atatatttga gcgtggtgtc atgtactggc atcccgaata tggagcccat       240
     gcagtcacgg gcgaccttct tcttcaatgg gcttactcgg gaggaattga gggtgtttta       300
     ggttatcctg caggtgaccc tgaactccaa gatgatggtt ggtatagaca agcctttgca       360
     gatggtttct tgcatggaaa acaactgagt acattttttc ccgcatggga cgagtttgca       420
     tgggacgatt ccgctggtgg cgaaccgggg gtactaatgt caaggcaggc ggcgaactat       480
     gataaaggac cagctggtgg aaataaatac actgatcagg tcgttcttga aactgaggat       540
     atgtgtggca atgaaataat cctccgtaga gggtggtaca actcggatgc ctccagaaaa       600
     gataagccgt gggggtacga taaaattcgg cacaaacatg gtgtttttag tttgtggtca       660
     gttagtacag tatttgaaaa ttcgtgtatc aacaggattg aaggtacaca gcaggtttat       720
     gaagaagaag tttatcaagt gaaatgtgat cgactcttct taaattgtga acaaaccggg       780
     cagtcttttg tatatcgcgg tatttatgaa agaaatatat ataagcctgg tgctacagag       840
     ccacttggtt tgaggacatt ttttcctgta cacaatgagg gaacgcatgg ttcaagtgat       900
     gtaaccccaa catggtttag tacagacatt ccaacattgg acttatggta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page