(data stored in ACNUC30630 zone)

EMBL: AP009044.PE598

AP009044.PE598       Location/Qualifiers
FT   CDS_pept        618743..619351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53527"
FT                   /db_xref="GOA:A4QBD0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD0"
FT                   /protein_id="BAF53527.1"
FT                   /translation="MGHEFGYARVSTNDQDARLQHDALTKAGCYRIFTDTASGSLESRP
FT                   ELDKLLDQLRPGDTLVVWRLDRLGRSIRHLIDQLATLQERGVEFRSLQENIDTSSSGGR
FT                   LVFHIFASLAEFERDLIRERTNAGLEAARARGRTGGRPPSLSGDKLRTARKLYEQKDMT
FT                   VAQIGEVLGVSRTTVYRALRRDTGALPTRKQASPGPLPG"
     atgggacatg aattcggtta cgcccgggta tccaccaatg atcaagatgc ccgactccaa        60
     cacgacgcac tgacaaaagc cggctgctac cggatcttca ccgacaccgc ctccggctcc       120
     ttggagtcgc gtcccgaact cgataaattg ctcgatcaac ttcgcccggg tgacacgttg       180
     gtggtgtggc gactggaccg gttgggtcgc tcgatcaggc acctcatcga tcaactcgcc       240
     acactccagg agcgtggggt ggagtttcgg tccctgcagg aaaacatcga cacctcctcc       300
     tccggcgggc gcttggtatt ccacatcttc gcctcactcg ccgagttcga gcgcgacctt       360
     attcgggagc ggaccaacgc cgggctcgag gccgcccggg cccgcggccg taccggcggc       420
     cggccgccct cacttagcgg ggataagttg cgcaccgcgc ggaaactcta cgaacaaaag       480
     gacatgaccg tcgcccagat cggcgaggtc ctcggtgtca gccgcaccac cgtctaccgg       540
     gcgctgcgcc gcgacaccgg cgccctgccc acgcgcaagc aagcctcccc gggtcctcta       600
     cccggctaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page