(data stored in ACNUC30630 zone)

EMBL: AP009044.PE61

AP009044.PE61        Location/Qualifiers
FT   CDS_pept        complement(67440..67904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53020"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X7"
FT                   /protein_id="BAF53020.1"
FT                   /translation="MDSLVLLGLRIALLVVLWFFVLMALRAMRADLKVTGQASTSSTSV
FT                   AAPQGLARAFNRSSPPRLLTVVEGPLAGSSIEVSEDMTMGRSPECTFVVGDDYASGMHA
FT                   RVFKRGSEWFVEDLDSRNGTFVGGTRIDQPEQIAVGTDIRIGRTTVRLVP"
     atggattctc tggtccttct tgggcttcgc atcgctttgc ttgtggtgtt gtggtttttc        60
     gtcttgatgg cgctgcgcgc tatgagggca gatttgaaag tgacgggtca agcgtcgaca       120
     agcagcacgt ccgtcgcggc accgcagggc cttgcccggg cctttaatcg ctccagcccg       180
     cctcgtcttt tgacggtggt cgagggcccg ttggcgggct cctcgattga ggtgtcggag       240
     gatatgacga tgggccgtag ccctgagtgc acgtttgtgg tgggcgatga ttacgcctcc       300
     ggcatgcatg cgcgggtgtt taagcgtggt tcggagtggt ttgtggagga tctggattcg       360
     cgcaacggca cttttgtcgg tggtacgcgc attgatcagc ctgagcagat tgcggtgggc       420
     acggatatcc gtattggtcg tacaacagtg aggcttgttc cctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page