(data stored in ACNUC30630 zone)

EMBL: AP009044.PE616

AP009044.PE616       Location/Qualifiers
FT   CDS_pept        complement(634442..634594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6034"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR95"
FT                   /protein_id="BAQ21096.1"
FT                   /translation="MLLWWIHLLFRARGNGLERFGRYSFIATFGDRVWIHSFGESSEMD
FT                   KKLFV"
     atgctcctgt ggtggataca ccttcttttc cgagcccgtg ggaacgggtt ggaacggttc        60
     ggccgctact cattcatcgc tacctttggt gatcgagtgt ggattcattc tttcggtgaa       120
     tccagtgaaa tggacaaaaa gctttttgtt taa                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page