(data stored in ACNUC30630 zone)

EMBL: AP009044.PE653

AP009044.PE653       Location/Qualifiers
FT   CDS_pept        677738..678580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53580"
FT                   /db_xref="GOA:A4QBI3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI3"
FT                   /protein_id="BAF53580.1"
FT                   /translation="MAIRKYKPTTPGRRASSVSMFTEITRSTPEKSLLRPLSKTGGRNS
FT                   HGHITTRHRGGGHKRRYRVIDFRRNDKDGVLAKVAHIEYDPNRTANIALLHYFDGEKRY
FT                   ILAPKGLTQGTVIESGAAADIKVGNNLPLRNIPTGTTIHNVELKPGAGAKLARSAGASI
FT                   QLLGKEGSYAVLRMPSSEIRRVDIRCRATVGEVGNAEQINIRWGKAGRMRWKGWRPTVR
FT                   GVVMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRKPKRYSDDMIVRRRRANKNKKR"
     atggctattc gtaagtacaa gccgacaacc ccgggtcgcc gcgcaagctc cgtttccatg        60
     ttcacggaga tcacccgttc gacccctgag aagtcacttc tccgcccact gagcaagacc       120
     ggcggacgta actctcacgg ccacatcacc acccgtcacc gcggtggtgg acacaagcgc       180
     cgctaccgcg tcatcgactt ccgtcgtaat gacaaggatg gcgtattggc gaaggtcgct       240
     cacatcgagt acgacccaaa ccgtaccgct aacattgcac tgcttcacta cttcgatggc       300
     gagaagcgtt acatcctcgc accgaagggc ctgacccagg gcaccgttat cgagtccggc       360
     gctgcagccg acatcaaggt tggtaacaac ctgccactgc gtaacatccc aactggtacc       420
     accatccaca atgtggagtt gaagccaggc gcaggtgcaa agctggcacg ttccgctggc       480
     gcttccatcc agcttcttgg taaggaaggc tcctacgcag ttctgcgtat gccatcctcc       540
     gagatccgac gcgtagacat ccgctgccgc gcgactgttg gtgaggtcgg caacgccgag       600
     cagatcaaca ttcgttgggg taaagctggt cgtatgcgtt ggaagggctg gcgcccaacc       660
     gtccgtggtg tcgttatgaa cccggtcgac cacccacacg gtggtggtga aggtaagact       720
     tctggtggtc gccacccagt ctccccatgg ggacagaagg aaggccgcac ccgcaagcct       780
     aagcgttaca gcgatgacat gatcgttcgt cgccgtcgtg ctaacaagaa caagaagcgc       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page