(data stored in ACNUC30630 zone)

EMBL: AP009044.PE675

AP009044.PE675       Location/Qualifiers
FT   CDS_pept        complement(691675..693384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53602"
FT                   /db_xref="GOA:A4QBK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK5"
FT                   /protein_id="BAF53602.1"
FT                   /translation="MSAPFSARTAWSTDPVLELESVAASYYDDERTLAAPQISDVNLTL
FT                   FEGEILLVVGRTGSGKSTLLNAMSGAMPHATGGRLDGRVRVVGRDTRDFPPRMLSDVVG
FT                   VVGQDPAASFITNTVEEELAYSMEQLGLPPAVMRKRVEETLDLLGIAELRYVPLAELSG
FT                   GEQQRVAIGAVLTTRPALIILDEPTSALDPNGAEDVLATVTKLAHDLAMTVVLAEHRIE
FT                   RVLQYVDRVAHVGADGHVTVGTPEEIMADADVAPPIVELGRWAGWAPLPLSIRDARAHS
FT                   ADMRKRLYQRGLVVNKLHNHAVQPLLIAEDIVVEFPEIRAVDGVNLNLNAGEITVLMGR
FT                   NGCGKSSLLWALQGSGTRNQGSVQVLDEATGFSWTDPKTLKPAKRRNLVSMVPQTPTDI
FT                   LYESTVHAELARSDKDAAAPAGTTREILDSLVPNIPDHLHPRDLSEGQKLSLALSIQLA
FT                   AKPRVVFFDEPTRGLDYDGKKSLARSFQQLADDGHAILVVTHDVEFSALCADRVLFMAS
FT                   GKIISDGTAVEILPASPAYAPQVAKITAGIQEESHWLTVSAVKAALGHGEIS"
     atgagtgctc cttttagcgc gcgcactgcg tggtcgacgg acccggtgct ggaactggaa        60
     agcgtggctg cctcgtatta tgacgatgag cgcacgctgg cggcgccgca gatcagcgac       120
     gtgaatctga cgctttttga aggcgaaatc ctgctggttg tggggcgcac cggctccggc       180
     aaatcgacgc tgctgaacgc gatgtccggc gcgatgccgc atgcgaccgg cggccgactt       240
     gatggacgcg tgcgggtggt cggccgggat acgcgtgatt tcccaccacg catgctttcc       300
     gacgtggtcg gcgtcgttgg gcaagatccg gcggcgagtt ttatcaccaa cacggttgaa       360
     gaagaacttg cctacagcat ggagcaatta gggctcccac ctgcggtcat gcgcaagcgc       420
     gtagaggaaa cccttgatct tttaggcatc gccgaactgc gatacgtgcc attggcggaa       480
     ctatctggtg gtgagcagca gcgcgtggcg attggcgcgg tgctgaccac ccgccccgcg       540
     ctgattatct tggacgaacc aaccagcgcg ttggatccca acggtgccga ggatgtgctg       600
     gcaaccgtga ccaagcttgc tcatgatctg gcgatgaccg tggtactcgc tgaacaccgc       660
     atcgagcgtg tgctgcagta cgtggaccgc gtggcgcatg tgggtgctga tgggcacgtc       720
     accgttggga cgccggaaga aatcatggct gatgctgatg tggcaccacc cattgtggaa       780
     ttggggcgct gggctggctg ggctccccta ccgctgtcga tccgcgatgc tcgcgcacac       840
     tccgctgaca tgcgcaaacg cctgtatcaa cgtggcttag tggtgaacaa attacacaac       900
     cacgctgtcc agccactttt gatcgccgaa gatatcgtgg ttgaattccc tgaaatccgt       960
     gccgttgatg gggtgaactt gaacctcaac gccggtgaaa ttaccgtgct catgggccga      1020
     aacggctgtg gaaaatcatc cctgttgtgg gctttgcaag gctcaggaac cagaaaccaa      1080
     ggctcggttc aggtgcttga tgaggccaca ggattttcgt ggacagatcc caaaacttta      1140
     aagcctgcca agcggcgcaa tcttgtgtcc atggtcccgc aaacaccgac cgatattttg      1200
     tatgaatcaa ccgttcatgc agaacttgcg cgctctgata aagatgccgc agcacccgct      1260
     ggcaccacgc gggaaatctt ggattcactg gtcccaaata tcccggacca tctccaccca      1320
     cgtgatctat cagagggcca aaaactttca ctcgcgttgt ctatccaact cgctgcgaaa      1380
     ccccgggtgg tgtttttcga tgaacccacc cgtggactgg attacgacgg caagaaatcc      1440
     ctcgcccgct ccttccaaca actcgcagac gacggccacg ccattttggt agtcacccac      1500
     gacgtggaat tctctgcact gtgcgccgac agagtgctgt ttatggcctc tggaaagatc      1560
     atctccgatg gcacagccgt agaaatcctc cccgcctcac cggcttacgc cccacaggtc      1620
     gcgaaaatca ccgccggaat ccaagaggaa tcacactggc tcactgtctc ggccgtgaaa      1680
     gctgcgctag ggcacggtga aatttcatga                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page