(data stored in ACNUC30630 zone)

EMBL: AP009044.PE679

AP009044.PE679       Location/Qualifiers
FT   CDS_pept        complement(697117..697587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53606"
FT                   /db_xref="GOA:A4QBK9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK9"
FT                   /protein_id="BAF53606.1"
FT                   /translation="MEEFGTDPIHGSGYFENYLPIDFSEAGFHHYLKERTDAADPSVPP
FT                   PEGFVHCSYFWIVDDDDVLVGFLALRHELNQHLLEVAGHIGYGVRPSARRKGAATAALK
FT                   LGIHEAQALGIDKVLLCVAGDNEASRNVIEKCGGVYESTIRGMRRYWIATDS"
     ttggaagaat tcggaactga ccccattcac ggttcgggtt atttcgagaa ctatcttccc        60
     atcgactttt ccgaggcagg ctttcaccac tacctcaagg agcgcactga cgcggccgat       120
     ccttcggttc caccaccgga aggttttgtg cactgcagct atttctggat cgttgatgat       180
     gacgatgttc ttgtcggatt cttagcttta aggcacgagc tgaaccaaca tctcctggaa       240
     gtcgcgggcc acattggtta cggcgtgcgc ccgtctgcgc gtcgaaaagg tgctgcaacc       300
     gcagcgctga aactcggtat tcatgaagct caggccttgg gcatcgacaa ggttttgctg       360
     tgcgtcgcag gagataacga agcgtccagg aacgtcatcg aaaagtgcgg tggagtttat       420
     gaatccacga tccgtggaat gcgacgctat tggatagcca cagattctta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page