(data stored in ACNUC30630 zone)

EMBL: AP009044.PE683

AP009044.PE683       Location/Qualifiers
FT   CDS_pept        699401..700036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53610"
FT                   /db_xref="GOA:A4QBL3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBL3"
FT                   /protein_id="BAF53610.1"
FT                   /translation="MPGRERRDGGRSADDNKQNDRNERRGGGRRDDRRNQQQDERSQYI
FT                   ERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQKGAEEARKNF
FT                   FRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIAGGAARPVLECAGIQDILSKSLGS
FT                   DNAINVVHATVDGLKQLVRPEEVAARRGKTIEEVAPARILRARAGQEA"
     atgccgggac gtgaacggcg tgacggcgga cgctccgccg acgacaacaa gcaaaacgat        60
     cgcaacgagc gtcgtggcgg aggccgccgc gatgaccgtc gtaatcagca gcaggacgag       120
     cgctcacagt acatcgagcg tgtagtcacc atcaaccgtg tgtccaaggt cgtcaagggt       180
     ggtcgtcgct tcagcttcac cgcacttgtc atcgttggcg acggcaaggg aatggtcggt       240
     gtcggttacg gcaaggccaa ggaagtccct gccgcaatcc agaagggtgc agaagaggct       300
     cgtaagaact tcttccgcgt cccaatggtc aacggcacca tcacccaccc agttcagggc       360
     gaaaaggcag ccggcatcgt tatgctgaag ccagctgctc caggtaccgg tgttatagcc       420
     ggtggcgcag cacgtccagt tcttgagtgc gcaggtatcc aagacatcct gtccaagtcc       480
     cttggctctg acaacgctat caacgtcgtc cacgcaactg tggacggcct gaagcagctg       540
     gtccgccctg aagaggttgc agcccgccgt ggcaagacca tcgaagaggt cgcaccagca       600
     cgtattctgc gtgcacgcgc aggtcaggag gcgtaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page