(data stored in ACNUC30630 zone)

EMBL: AP009044.PE69

AP009044.PE69        Location/Qualifiers
FT   CDS_pept        complement(76511..77314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53027"
FT                   /db_xref="GOA:A4Q9Y4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y4"
FT                   /protein_id="BAF53027.1"
FT                   /translation="MANSPSGESMIARVVRLLSVFPKYNRPLSVREIAEYASLPVTTTH
FT                   RLLKELEAEDLVTRMTDGGWQHGTRLWEIASRNSPVQSLRDAALPPMEDLVAGLRVHVS
FT                   LAILDRHEVLYLERITPDDYTVNITSVAGRLPAHATSAGLVLHAFGSQEGQRLFLSRGH
FT                   ARFTETTPTEIEQLKEKLSRARIDGFVASLGTIIPESTGISVPIFGPKKLAIAALTVIV
FT                   PIGDEDLDLIVPQMKITARAIQRRTGVVPEINSRVTRETRQSPLG"
     atggccaatt ccccatctgg cgaatccatg atcgctcgag tcgtgcgcct tttatctgtg        60
     ttccccaagt acaaccgccc attgagcgtc cgggaaattg cagagtatgc ctcgctccca       120
     gtaactacta ctcaccggtt gctcaaggag ttggaggcag aagatttagt aacccgcatg       180
     accgatggcg gatggcaaca cggcactagg ttgtgggaaa ttgcctcccg aaactctcca       240
     gttcaatcgc tgagggatgc tgcacttcct ccaatggaag atctagtcgc aggacttcga       300
     gtccatgttt ctttggctat tttggaccgc catgaagtgc tttatttgga gagaattact       360
     ccggatgatt acacagttaa catcacgtcg gtggcgggta ggttgcctgc acatgctact       420
     tccgctggtt tagtgcttca cgcttttggt tcgcaagaag gtcaacggtt gtttttaagc       480
     cgtggtcatg cgcgttttac agaaactact cccacggaga ttgagcagtt gaaggagaag       540
     ctaagtcgtg cacgcatcga tggttttgta gcttcactag gaacaatcat ccctgaatct       600
     acgggtattt ctgtgcccat tttcgggcct aagaagcttg cgattgctgc tctcaccgtc       660
     attgttccga tcggggatga agatttggat ctcattgtcc cgcaaatgaa aatcaccgcc       720
     agagcgatcc agcggcgtac aggagttgtc ccagaaataa attcgagggt gacgcgtgaa       780
     actagacagt cacccttggg ataa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page