(data stored in ACNUC30630 zone)

EMBL: AP009044.PE691

AP009044.PE691       Location/Qualifiers
FT   CDS_pept        705713..706687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53618"
FT                   /db_xref="GOA:A4QBM1"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM1"
FT                   /protein_id="BAF53618.1"
FT                   /translation="MTTAVAPDTNADTAGQQRFDEIIAADSRIEPTDWMPAAYRKTLTR
FT                   QISQHAHSEIIGMQPEANWISRAPSLKRKAILMAKVQDEAGHGLYLYSAAETLGTSRDE
FT                   LVNQLLEGKAKYSSIFNYPARTWADIGAIGWLVDGAAICNQVPLCRASYAPYARAMVRI
FT                   CKEESFHQRQGWEILYELSHGTPEQKQMAQEAINRLYRPALQMFGPPDADSAHSGQSMK
FT                   WNIKRFSNDELRQRFVDMIVPQVEALGLTFEDPDLKWNEERGHYDFGELDWDEFFNAIN
FT                   GNGPLNSQRLKRRREAFDDGAWVREAAAAYDRKHNRVDTALVV"
     atgactacag cagttgcacc tgacacaaac gcagatacag ctgggcaaca gcgcttcgat        60
     gagatcatcg cggcggattc ccgaattgaa cctactgact ggatgccagc ggcataccgc       120
     aagacactga cccgccagat ttctcagcac gcacactctg agatcatcgg catgcagcct       180
     gaggctaact ggatttcccg agcaccatct ctgaagcgca aagcaatcct gatggccaag       240
     gttcaggatg aagcaggcca cggcctatac ctgtactcgg ctgctgaaac actgggcacc       300
     tctcgcgatg agctggttaa tcagcttctg gaaggcaaag ccaaatattc ctccatcttc       360
     aattacccag ctcgcacctg ggcagacatc ggagcaatcg gctggttggt tgatggcgct       420
     gctatttgta accaggtgcc actctgccgc gcttcctatg cgccatatgc tcgcgcaatg       480
     gttcgaatct gtaaggaaga atccttccac cagcgccaag gctgggaaat tttgtacgaa       540
     ctttcccatg gcaccccaga gcaaaagcag atggcacagg aagcaatcaa ccgcttgtac       600
     cgtccagcac tgcaaatgtt cggaccaccg gatgcagatt ctgcgcactc tggacagtcc       660
     atgaaatgga acattaaacg gttctccaat gatgagctgc gtcagcgttt cgtcgacatg       720
     attgttccgc aggttgaggc actgggactg acgtttgaag atccggatct gaaatggaac       780
     gaggaacgcg gtcactacga cttcggagag ctcgattggg atgagttctt caatgccatt       840
     aatggtaacg gaccgctgaa ttcccaacgt ttgaagcgac gtcgagaagc attcgatgac       900
     ggcgcctggg tgcgcgaggc tgccgcggcc tacgaccgca agcacaaccg cgtcgacact       960
     gcattagttg tttaa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page