(data stored in ACNUC30630 zone)

EMBL: AP009044.PE697

AP009044.PE697       Location/Qualifiers
FT   CDS_pept        710443..711648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53624"
FT                   /db_xref="GOA:A4QBM7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM7"
FT                   /protein_id="BAF53624.1"
FT                   /translation="MSDRTAYLVSGKRTPVGRYGGALSSVRPDDLAALTITAVIEESGI
FT                   DPSVVDEVILGNANGAGEENRNVARLAWLLAGYPDTVPGITVNRLCASGMSAIALATAM
FT                   VESGQADVVVAGGVESMSRAPWVQEKPRSAFAKPGEIFDTSIGWRFVNPIFQEQEKTTF
FT                   SMPETAEEVARVKGVSREEADVFAATSQARALAAISAGHFDSEIVPVEITDRKGNVTVV
FT                   SQDEGPREGTTTQVLAKLRPVVRGGEVVTAGNSSSLNDGASAIIVASAEAVEKYGLTAR
FT                   AKVVGASNAGLAPEIMGMGPVPATKKLLKRTGWSVEDLDAVELNEAFATQSLACMRELE
FT                   LDPEKVNAWGGAIALGHPLGSSGSRITITLLNRLEKEGGSKGIATMCIGVGQGSAIAIE
FT                   RV"
     gtgagcgatc gaaccgcata tcttgtctcc ggcaaaagaa caccagtggg ccgctacggt        60
     ggggcactct cctcagttcg ccctgatgat ctagcagccc tcaccatcac tgccgtcatt       120
     gaagaatcag gcattgatcc atcagtggtg gatgaggtca ttttaggaaa tgccaacggt       180
     gctggcgaag aaaaccgcaa cgttgcacgc ctggcatggc ttttggcggg atacccagac       240
     accgttcctg gaattaccgt gaacaggctt tgcgcttctg gaatgtctgc cattgcgttg       300
     gctactgcga tggtggaatc aggacaagct gatgtggtgg ttgccggtgg tgtggaatct       360
     atgtcgaggg caccgtgggt gcaggaaaag ccacgatcgg ctttcgctaa gccgggtgag       420
     atttttgata cctcgattgg ttggcgtttc gtgaacccta ttttccagga gcaggagaag       480
     accacgttct ccatgccgga aactgcggaa gaagtcgctc gggttaaggg cgtgtcacgt       540
     gaggaagctg atgtgtttgc agcgacctcg caagctcgtg ctttggctgc gatttcggct       600
     ggacattttg attctgaaat cgtcccggtt gaaatcactg atcgtaaagg caacgtgacc       660
     gtggtgtcgc aagacgaagg tccacgtgaa ggcaccacta ctcaggtgtt ggcaaagctg       720
     cggccggtgg tgcgtggggg agaggtagtt actgccggaa attcctcgtc gcttaatgat       780
     ggagcgtccg ccatcatcgt ggctagcgct gaagctgtag agaaatacgg tttgacggct       840
     cgtgcgaagg ttgttggtgc cagcaatgca ggtcttgccc cagagatcat gggtatgggg       900
     cctgtgccag ctactaagaa acttctcaag cgcactggct ggagcgtcga agacctggac       960
     gctgtagagc tcaacgaagc attcgcaact cagtcgcttg cctgcatgcg ggaactcgaa      1020
     cttgatccag aaaaggtcaa tgcgtggggc ggtgccattg cgttgggcca cccactgggt      1080
     tcttctggtt ccagaatcac catcacactg cttaaccgcc tggaaaaaga aggcggatcc      1140
     aagggcattg ccaccatgtg tatcggagtc ggtcagggct ccgcgatcgc tatcgaaagg      1200
     gtgtag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page