(data stored in ACNUC30630 zone)

EMBL: AP009044.PE707

AP009044.PE707       Location/Qualifiers
FT   CDS_pept        complement(720360..721106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53634"
FT                   /db_xref="GOA:A4QBN7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN7"
FT                   /protein_id="BAF53634.1"
FT                   /translation="MPSPRTVLITGAAGGLGRAFAEGFAAQGDRIAVADINLDGAQETV
FT                   DKLKALGADAAAFEVDVTSLESTEALAAGVTEFGGGRIDALINNAAVYATVTRSPFEDI
FT                   DPAEWDLVMGVNLKGPWLVTRSVSPFLSDNARVVNLSSATVFSGSAHWAHYVASKGGVI
FT                   ALTRVLAKELGGRGITVNAVAPGFTLTEASLGLMDNAETYGVERGSIKRASQPKDIVGT
FT                   TMFLASPEAEYITGQTLIVDGGRQFI"
     atgcctagtc cacgcactgt tcttatcact ggtgccgctg gcggtttggg tcgggcattc        60
     gctgaaggtt tcgcagccca aggagaccgt atcgcggtgg cggatatcaa tctggatggg       120
     gcgcaagaga ccgttgacaa gctgaaagca ttgggcgcag atgccgcagc ctttgaagtt       180
     gatgtcacgt ctttggagtc caccgaggcg ctagccgctg gtgtcactga gtttggcggt       240
     ggtcggattg atgcccttat taataacgca gcggtatatg caacggtgac tcgttcgcca       300
     tttgaggata ttgatcctgc ggagtgggat ttggttatgg gagtcaacct caaaggcccg       360
     tggttggtga ctcgttccgt gagcccgttt ttatccgata atgcccgcgt ggtcaatctt       420
     tccagtgcga ctgtgttttc aggatctgcg cactgggcgc actatgtagc atccaaaggt       480
     ggagtcattg ctttaaccag ggtgcttgct aaagagctgg gtggtcgtgg gatcacggtc       540
     aatgcggttg cgcctgggtt tacgctgacc gaagccagct tggggctcat ggataacgcg       600
     gaaacgtacg gtgtcgagcg cggatccatc aagcgcgcaa gccaaccgaa agacatcgtc       660
     ggtaccacca tgttccttgc atccccagaa gccgaataca tcactgggca aacgctcatc       720
     gttgatggcg gccgacagtt catctaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page