(data stored in ACNUC30630 zone)

EMBL: AP009044.PE71

AP009044.PE71        Location/Qualifiers
FT   CDS_pept        complement(80263..81735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53029"
FT                   /db_xref="GOA:A4Q9Y6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y6"
FT                   /protein_id="BAF53029.1"
FT                   /translation="MTINVSELLAKVPTGLLIGDSWVEASDGGTFDVENPATGETIATL
FT                   ASATSEDALAALDAACAVQAEWARTPARERSNILRRGFELVAERAEEFATLMTLEMGKP
FT                   LAEARGEVTYGNEFLRWFSEEAVRLYGRYGATPEGNLRMMTTRKPVGPCLLITPWNFPL
FT                   AMATRKVAPAIAAGCVMVLKPARLTPLTSQYFAQTMLDAGLPAGVLNVVSGASASAISN
FT                   PIMEDDRLRKVSFTGSTPVGQQLLKKAADKVLRTSMELGGNAPFIVFEDADLDLAIEGA
FT                   MGAKMRNIGEACTAANRFLVHESVADEFGRRFAARLEEQVLGNGLDEGVTVGPLVEAKA
FT                   RDSVASLVDAAISEGATVLTGGKAGTGAGYFYEPTVLTGVSTDAAILNEEIFGPVAPIV
FT                   TFQTEEEALRLANSTEYGLASYVFTQDTSRIFRVSDGLEFGLVGVNSGVISNAAAPFGG
FT                   VKQSGMGREGGLEGIEEYTSVQYIGIRDPYAG"
     atgactatta atgtctccga actacttgcc aaagtcccca cgggtctact gattggtgat        60
     tcctgggtgg aagcatccga cggcggtact ttcgatgtgg aaaacccagc gacgggtgaa       120
     accatcgcaa cgctcgcgtc tgctacttcc gaggatgcac tggctgctct tgatgctgca       180
     tgcgctgttc aggccgagtg ggctaggacg ccagcgcgcg agcgttctaa tattttacgc       240
     cgcggttttg agctcgtagc agaacgtgca gaagagttcg ccaccctcat gaccttggaa       300
     atgggcaagc ctttagctga agctcgcggc gaagtcacct acggcaacga attcctgcgc       360
     tggttctctg aggaagcagt ccgcctctac ggccgctacg gtgccacccc agaaggcaac       420
     ctgcgcatga tgaccacccg caaaccagtt ggcccctgcc tgttgatcac cccatggaac       480
     ttcccactag caatggccac ccgtaaggtt gcacccgcca tcgctgcagg ttgtgtcatg       540
     gtgctcaagc cagctcgcct gaccccactg acctcccagt attttgccca gaccatgctt       600
     gatgccggtc ttccagcagg tgtcctcaat gtggtctccg gcgcttccgc ctctgcgatt       660
     tccaacccca ttatggaaga cgatcgcctc cgcaaagtct ccttcaccgg ctccacccca       720
     gttggccagc agctactcaa aaaggctgcc gataaagttc tgcgcacctc catggaactc       780
     ggcggcaacg caccattcat cgtcttcgaa gacgccgatc tggacctcgc catcgaaggc       840
     gctatgggtg caaagatgcg caacatcggc gaagcctgca ccgcagctaa ccgtttctta       900
     gtccacgaat ccgtcgccga tgaattcggc cgccgcttcg cagcccgcct cgaggaacaa       960
     gtcctaggca acggcctcga cgaaggcgtc accgtgggcc ccctggttga ggcaaaggca      1020
     cgggatagcg ttgcatcgct tgtcgacgcc gccatctccg aaggtgccac cgtcctcacc      1080
     ggcggcaagg ccggcacagg tgcaggctac ttctacgaac caacggtgct cacgggagtt      1140
     tcaacagatg cagccatcct gaacgaagag atcttcggtc ccgtcgcacc gatcgtcacc      1200
     ttccaaaccg aggaagaagc tctgcgtcta gccaactcca ccgaatacgg actggcctcc      1260
     tacgtgttca cccaagacac ctcacgcatc ttccgcgtct ccgatggtct cgagttcggc      1320
     ctagtgggcg tcaactccgg tgtcatctct aacgccgctg caccttttgg tggcgtgaag      1380
     caatccggaa tgggccgcga aggtggcctc gaaggaattg aagagtacac ctccgtgcag      1440
     tacatcggca tccgggatcc ttacgccggc tag                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page