(data stored in ACNUC30630 zone)

EMBL: AP009044.PE712

AP009044.PE712       Location/Qualifiers
FT   CDS_pept        726828..728150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53639"
FT                   /db_xref="GOA:A4QBP2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP2"
FT                   /protein_id="BAF53639.1"
FT                   /translation="MSAIIQAFKDADLRKKIFFTIAMIVLYRIGAQIPSPGVDYATISG
FT                   RLRDLTQDQSSVYSLINLFSGGALLQLSIFAIGIMPYITASIIVQLLTVVIPHFEELKK
FT                   EGQSGQAKMMQYTRYLTVALALLQSSGIVALADREQLLGAGIRVLSADRNFFDLIVLVI
FT                   TMTAGAVLVMWMGELITEKGVGNGMSLLIFAGIATRLPTDGMNILGNSGGVVFAVVLAS
FT                   VLILVIGVVFVEQGQRRIPVQYAKRMVGRRQYGGSSTYLPLKVNQAGVIPVIFASSLIY
FT                   MPVLITQIVNSGSLEVSDNWWQRNIIAHLQTPSSWQYIVLYFALTIFFSYFYVSVQYDP
FT                   AEQAENMKKYGGFIPGIRPGRPTAEYLGFVMNRLLFVGSLYLAVIAVLPNIMLDLGVDA
FT                   GSAGATPFGGTAILILVSVALTTVKQIESQLLQSNYEGLLK"
     gtgtccgcca ttattcaggc attcaaggac gccgatctgc gtaagaagat tttcttcact        60
     atcgcaatga tcgttctata ccgcatcggt gcgcagatcc cttccccggg agttgactat       120
     gcaacgatta gtggtcgtct gcgtgacttg actcaggatc agtcaagcgt ttattcgctg       180
     attaacctgt tttccggtgg agcgctgctg cagctgtcca tttttgctat tggtatcatg       240
     ccgtacatca cggcgtctat tatcgtgcag ctgctgactg tggttattcc acactttgag       300
     gagttgaaga aggaaggcca gtctggccag gccaagatga tgcagtacac caggtactta       360
     acggttgcct tggcgttgct tcagtcttcg ggcatcgtcg cgttggcgga ccgtgagcag       420
     ctgcttggcg caggcattcg cgtgctgtcg gctgatcgca acttcttcga cctcattgtt       480
     ttggtcatca ccatgactgc gggtgcagtg cttgtgatgt ggatgggtga gctcatcacg       540
     gaaaagggcg taggcaatgg tatgtcgctg ctgattttcg ctggtatcgc aactcgcctc       600
     ccaactgatg gcatgaacat tctgggcaac tccggcggcg tggttttcgc tgttgttctg       660
     gcttccgttc tgatcctggt cattggtgtt gtattcgttg agcagggcca gcgtcgtatt       720
     ccagtgcagt acgcaaagcg catggtgggt cgtcgtcagt acggtggttc ttccacttac       780
     ctgcctttga aggtcaacca agctggtgtt atcccagtga tcttcgcgtc ttccttgatt       840
     tacatgccag tgctgattac tcagatcgtg aactctggtt cgctggaagt gtctgataac       900
     tggtggcagc gcaacatcat tgcgcacctg cagacgcctt cttcctggca gtacattgtt       960
     ttgtactttg cactgaccat cttcttctct tacttctatg tttctgttca gtatgatcca      1020
     gctgagcagg ctgaaaacat gaagaagtac ggcggattta tccctggtat tcgtccgggc      1080
     cgtccgactg ctgagtactt gggattcgtc atgaaccgcc tgctgtttgt tggttccctg      1140
     tacctggctg tcattgctgt gctgccaaac attatgctgg atctaggtgt tgacgccggt      1200
     tcggccggag caactccatt cggcggaacc gcaatcttga ttcttgtatc tgttgcactg      1260
     accacagtga agcagattga gagccagctc ctgcaaagca actacgaagg acttctaaaa      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page