(data stored in ACNUC30630 zone)

EMBL: AP009044.PE713

AP009044.PE713       Location/Qualifiers
FT   CDS_pept        complement(728129..728611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53640"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP3"
FT                   /protein_id="BAF53640.1"
FT                   /translation="MIDQRSSLIAVDTETGADGLFVVISATAGQHALHDDVFRNLVVNN
FT                   TIEGLASFGKQVSQDVSLLNGAWETIQKEAFCSIGLSKAGSNHTCSHVGWNQLASVDVL
FT                   LGLDTQRGTLANVGAEKIASRNVRNAKLLRENCSLGALTSTGRSEEYESHYFRSPS"
     gtgatcgatc agaggagcag tctcatcgcg gtagacaccg agacgggtgc ggatggtctc        60
     ttcgttgtca tcagcgcgac cgcgggacag catgcgctcc acgacgacgt cttcagaaac       120
     ctggtagtta acaacaccat cgagggtctg gccagcttcg gaaagcaggt tagccaagat       180
     gtcagcctgc tcaacggtgc gtgggaaacc atccaaaagg aagccttctg cagcatcgga       240
     ctcagcaagg cgggaagcaa ccatacgtgc agtcacgtcg gttggaacca gcttgccagc       300
     gtcgatgtac tgcttggcct cgatacccag aggggtaccc tcgccaatgt tggcgcggaa       360
     aagatcgcca gtagaaatgt gaggaatgcc aagcttctca gagagaattg cagcctgggt       420
     gcccttacca gcaccgggag gtccgaggag tacgagtcgc attattttag aagtccttcg       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page