(data stored in ACNUC30630 zone)

EMBL: AP009044.PE732

AP009044.PE732       Location/Qualifiers
FT   CDS_pept        746579..746962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53659"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR2"
FT                   /protein_id="BAF53659.1"
FT                   /translation="MPVSVSDVLQLAATSSSPRLSGLDAGPTHQENGRSACSTKAVVSA
FT                   IRAAAISGEKRAPVMMSNVSSSRPLSAMSRSSVCVIVADARCRWRWQKCSAKFSSIARC
FT                   NLPRSFRKLHFRYHKGAISRTHC"
     atgcctgttt cggtttcgga tgtgctccaa ttagccgcaa cgagcagctc gccgagattg        60
     tcagggctgg atgcggggcc gacccaccag gaaaacggac ggagtgcatg ttctacaaaa       120
     gcggtggttt cagcaatccg cgcagctgca atctcagggg aaaagcgcgc tcctgtaatg       180
     atgtcgaacg tgtcatcgtc gaggccactg tctgcgatga gcaggtcatc ggtgtgtgtg       240
     attgttgcgg atgcaagatg ccggtggaga tggcagaaat gctccgctaa gttctcttcg       300
     attgcgcgtt gtaatttacc gaggtccttc agaaaacttc attttaggta tcacaaaggt       360
     gccataagtc gcacccattg ttag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page