(data stored in ACNUC30630 zone)

EMBL: AP009044.PE735

AP009044.PE735       Location/Qualifiers
FT   CDS_pept        750005..751312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53662"
FT                   /db_xref="GOA:A4QBR5"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR5"
FT                   /protein_id="BAF53662.1"
FT                   /translation="MSNAVAQDLMTIADIVEATTTAPIPFHITAFDGSFTGPEDAPYQL
FT                   FVANTDAVSYIATAPGDLGLARAYLMGDLIVEGEHPGHPYGIFDALKEFYRCFKRPDAS
FT                   TTLQIMWTLRKMNALKFQEIPPMEQAPAWRKALINGLASRHSKSRDKKAISYHYDVGNE
FT                   FYSLFLDDSMTYTCAYYPTPESSLEEAQENKYRLIFEKLRLKEGDRLLDVGCGWGGMVR
FT                   YAAKHGVKAIGVTLSEQQYEWGQAEIKRQGLENLAEIRFMDYRDVPETGFDAISAIGII
FT                   EHIGVNNYPDYFELLSSKLKTGGLMLNHSITYPDNRPRHAGAFIDRYIFPDGELTGSGT
FT                   LIKHMQDNGFEVLHEENLRFDYQRTLHAWSENLKENWEEAVELAGEPTARLFGLYMAGS
FT                   EWGFAHNIVQLHQVLGVKLDEQGSRGEVPERMWWTI"
     atgagtaacg ccgtagcgca ggacctcatg accatcgccg acatcgtcga ggccacgacc        60
     actgcaccca tcccattcca catcactgcg ttcgatggaa gcttcactgg ccctgaagat       120
     gctccctacc agctgtttgt tgccaacacg gatgcagtat cctacatcgc aacagcgcca       180
     ggagatttgg gtttggcacg tgcctacctc atgggagacc tcatcgtgga aggtgagcat       240
     cccggccatc cttatgggat ctttgatgcg ttgaaggagt tctaccgctg cttcaaacgc       300
     ccagatgcat ccaccacctt gcagatcatg tggactctgc ggaaaatgaa tgccttaaaa       360
     ttccaggaaa ttccaccaat ggaacaagcc cccgcatggc gtaaagcact gatcaacggg       420
     ctagcatcca ggcactcgaa atcccgcgac aagaaagcca ttagctacca ctacgacgtg       480
     ggcaatgagt tctactccct gtttttagat gattccatga cctatacctg tgcgtattat       540
     ccaacgccag aatcaagttt ggaagaagcc caagaaaaca aataccgcct catctttgaa       600
     aaactgcgtc tgaaagaagg cgatcgcctc ctagacgtgg gatgcggttg gggaggtatg       660
     gtccgctacg ccgccaaaca cggtgtgaaa gccatcggag ttacgctgtc tgaacagcaa       720
     tatgagtggg gtcaagcaga gatcaaacgc caaggtttgg aaaacctcgc ggaaattcgc       780
     ttcatggatt accgcgatgt tccagaaact ggattcgatg cgatctcagc aatcggcatc       840
     attgaacaca tcggtgtgaa caactatccc gactactttg aattgctcag cagcaaactc       900
     aaaacaggcg gactgatgct caaccacagc atcacctacc cagacaaccg cccccgccac       960
     gcaggtgcat ttattgatcg ctacattttc cccgacggtg aactcactgg ctctggcacc      1020
     ctgatcaagc acatgcagga caacggtttc gaagtgctgc acgaagaaaa cctccgcttt      1080
     gattaccaac gcaccctgca cgcgtggtcc gaaaacctca aagaaaattg ggaggaagca      1140
     gttgaactcg ccggtgaacc cactgcacga ctctttggcc tgtacatggc aggttcggaa      1200
     tggggatttg cccacaacat cgtccagctg caccaagtac tgggtgtgaa actcgatgag      1260
     cagggaagtc gcggagaagt tcctgaaaga atgtggtgga ctatctaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page