(data stored in ACNUC30630 zone)

EMBL: AP009044.PE747

AP009044.PE747       Location/Qualifiers
FT   CDS_pept        764064..765611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53674"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS7"
FT                   /protein_id="BAF53674.1"
FT                   /translation="MNDPLAGYGAVVSALQGASGGMYRGPAKSEGQLREMYQTIEGLDT
FT                   SSLREAAEAAVGGTNEARIQGWVGPLLKFFGTVGGGMIATEIAERAVDWFKNRNDVEDV
FT                   SEAADKAADAIDSTVTESDQGMMHIIQQLLDIVSTLTQILGSMDRGKFPQEFRDCVQTG
FT                   ADLIDQAGDMLEGLCADRDEAISQCFSALTDHGKQVCETEPKPLCSAASGGSSGGATSS
FT                   AAASSGGSSSSTASSGSSGGSSSAADSSTSTNAESSVEKEKTTPAAVEKPDEKPVEKPV
FT                   EKTPEKPPEKPVEKPVEKQECEEKPDPKPNPKPDPDPEKCKTEPVECEPTPKPETEPEP
FT                   KPTPTPTPGTPTPIPDLETEDCEPGKETVTDSESESEECDPELNDVPEESDLIGQLIKG
FT                   AIGIGIVVVGVGLLVNFLEQCVPVIEEVSVPEPEPIPKPAPQPEPTSVKPPESELDKVA
FT                   EPAPKPIPQANYTAAAATNYSAPAHAPVVPITPAAPEVPAAPEVPAPAVNLHKAGGW"
     gtgaatgatc ctttagccgg ctacggagca gtggtctccg cactacaagg cgccagtggt        60
     gggatgtatc gcggaccggc gaaatccgaa ggccagttgc gcgagatgta ccaaaccatc       120
     gaagggctag acaccagctc gttgcgcgaa gctgccgaag cagcagtggg cggaacgaac       180
     gaagccagaa tacaagggtg ggtcggcccg ctcttgaaat tcttcgggac ggttggcggg       240
     ggaatgatcg ccacggagat agctgaacgg gcagtcgatt ggttcaaaaa ccgtaacgat       300
     gtggaagacg tcagcgaagc cgctgataaa gccgcagatg cgatcgactc cactgtcaca       360
     gagtccgacc agggcatgat gcacattatc cagcagctct tggacattgt gtctacgttg       420
     acgcagattc ttggcagcat ggatcggggg aaatttcctc aagaattccg ggactgtgtc       480
     caaactggag ctgatcttat tgaccaggca ggggacatgc ttgaaggatt gtgcgctgat       540
     cgagatgagg cgatttcaca gtgtttctcc gcgttgaccg atcatggaaa acaagtttgt       600
     gaaactgagc caaagccgtt gtgtagtgca gcttctgggg gttcatctgg tggagcgact       660
     tcttcggctg cggcctcttc aggtggttca agctcgagca ctgctagctc tgggagttct       720
     ggcggatcga gcagtgctgc ggatagttcg acgtcgacca atgctgaatc cagtgttgaa       780
     aaggaaaaga ccacacctgc tgccgttgag aaacctgacg agaaaccagt ggagaagccg       840
     gttgaaaaga cgccagaaaa gccgccagaa aagccggtag aaaaacctgt cgagaagcaa       900
     gagtgtgaag aaaagcctga tccaaagccg aacccaaagc ctgaccctga cccggaaaaa       960
     tgcaaaacag agccggtcga gtgtgagcca acaccgaaac ctgaaacaga gcctgaacca      1020
     aaaccgacac ccacgcccac acccggaaca ccaacaccaa tacctgatct agagactgag      1080
     gattgtgaac ctggcaagga gacggtcaca gactcagaat ctgaatcgga agagtgcgac      1140
     cccgagctca atgacgttcc agaagagtcg gatctgattg ggcaactcat caagggagca      1200
     atcggtattg ggattgttgt tgtaggcgtt gggctgttgg tgaatttcct ggagcagtgc      1260
     gtccctgtga ttgaagaagt atctgtgccg gagcccgagc ctatacctaa acccgctccg      1320
     cagcctgagc caacttcagt gaaaccacca gagtctgaat tagataaggt ggctgagcct      1380
     gcgccgaagc caattccaca agctaattac actgctgctg cagcgactaa ctattccgct      1440
     cccgcgcacg ctcccgttgt cccaattacg ccggcagcac ctgaagttcc ggcagcacca      1500
     gaagtgcctg caccggcggt taatcttcac aaggccggcg ggtggtag                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page