(data stored in ACNUC30630 zone)

EMBL: AP009044.PE748

AP009044.PE748       Location/Qualifiers
FT   CDS_pept        complement(765590..765907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53675"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS8"
FT                   /protein_id="BAF53675.1"
FT                   /translation="MILFGTNAVLRFCTNQDHPFLVLGFPQYRFHRPPTSLLSPCHPNR
FT                   FFQRLNHNRLFLLFHIFRHIIKLSLSRSDCLFELFHPLSCALSKLLEKFRILHRYHPPA
FT                   L"
     gtgattttgt ttggtactaa cgcggtcttg cggttttgta ccaaccaaga tcaccccttt        60
     ctagttttag gcttcccgca gtaccgattt cacaggcccc cgacctctct gttgtcgcct       120
     tgccatccga atcggttttt ccagagactc aaccacaaca ggctgtttct tcttttccac       180
     atcttccgcc acatcatcaa gctttcgttg agtcgaagcg attgcctttt cgaactcttc       240
     catccgctta gctgtgcgct ctcgaaactg ctggagaaat tccgcatact ccaccgctac       300
     cacccgccgg ccttgtga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page