(data stored in ACNUC30630 zone)

EMBL: AP009044.PE751

AP009044.PE751       Location/Qualifiers
FT   CDS_pept        766877..767962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53677"
FT                   /db_xref="GOA:A4QBT0"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBT0"
FT                   /protein_id="BAF53677.1"
FT                   /translation="MNLLTTKIDLDAIAHNTRVLKQMAGPAKLMAVVKANAYNHGVEKV
FT                   APVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTPEQDFRAAIDRNIDLAVISPA
FT                   HAKALIDTDAEHIRVSIKIDSGLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLACAD
FT                   EPENPETDRQIIAFRRALALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGLAFYGL
FT                   EPVAGREHGLKPAMTWEAKVSVVKQIEAGQGTSYGLTWRAEDRGFVAVVPAGYADGMPR
FT                   HAQGKFSVTIDGVDYPQVGRVCMDQFVISLGDNPHGVEAGAKAVIFGENGHDATDFAER
FT                   LDTINYEVVCRPTGRTVRAYV"
     atgaacttgc tgaccaccaa aattgacctg gatgccatcg cccataacac gagggtgctt        60
     aaacaaatgg cgggtccggc gaagctgatg gcggtggtga aggcgaatgc atataaccat       120
     ggcgtggaga aggtcgctcc ggttattgct gctcatggtg cggatgcgtt tggtgtggca       180
     actcttgcgg aggctatgca gttgcgtgat atcggcatca gccaagaggt tttgtgttgg       240
     atttggacac cggagcagga tttccgcgcc gccattgatc gcaatatcga tttggcggtt       300
     atttctcccg cgcatgccaa agccttgatc gacactgatg cggagcatat tcgggtgtcc       360
     atcaagattg attctgggtt gcatcgttcg ggtgtggatg agcaggagtg ggagggcgtg       420
     ttcagcgcgt tggctgctgc cccgcacatt gaggtcacgg gcatgttcac gcacttggcg       480
     tgcgcggatg agccagagaa tccggaaact gatcgccaaa ttattgcttt tcgacgcgcc       540
     cttgcgctcg cccgcaagca cgggcttgag tgcccggtca accacgtatg caactcacct       600
     gcattcttga ctcgatctga tttacacatg gagatggtcc gaccgggttt ggccttttat       660
     gggttggaac ccgtggcggg acgagagcat ggtttgaagc cggcgatgac gtgggaagcg       720
     aaggtgagcg tcgtaaagca aattgaagct ggacaaggca cttcctatgg cctgacctgg       780
     cgcgctgagg atcgcggctt tgtggctgtg gtgcctgcgg gctatgccga tggcatgccg       840
     cggcatgccc aggggaaatt ctccgtcacg attgatggcg tggactatcc gcaggttggg       900
     cgcgtgtgta tggatcagtt cgttatttct ttgggcgaca atccacacgg cgtggaagct       960
     ggggcgaagg ccgtgatatt cggtgagaat gggcatgacg caactgattt tgcggagcgt      1020
     ttagacacca ttaactatga ggtagtgtgc cgaccaaccg gccgaactgt ccgcgcatat      1080
     gtgtaa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page