(data stored in ACNUC30630 zone)

EMBL: AP009044.PE754

AP009044.PE754       Location/Qualifiers
FT   CDS_pept        770333..771616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53680"
FT                   /db_xref="GOA:A4QBT3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBT3"
FT                   /protein_id="BAF53680.1"
FT                   /translation="MVGVVSTPARNLGSMTKTLGSLQLEEITLTLPLTEDVADERTIDV
FT                   FARIATRVGGEDLPYLVFLQGGPGNEAPRPSLNPLNPNWLGVALEEYRVVMLDQRGTGR
FT                   STPVGNDILEKPTAEVVEYLSHLRADGIVRDAEALRKHLGVNQWNLLGQSFGGFTTLHY
FT                   LSRHADSLDNVFITGGLSAIDRPAEDVYANCYNRMRRNSEEFYGRFPQLRETFRGLVNR
FT                   ARAGEIVLPTGEVVSETRLRSLGHLLGSNDGWFDLYNLLELDPTSNAFVHDLAGLLPFG
FT                   NRNPIYYVLHESSYADGVVTNWAAERVLPEDFREDPTLLTGEHVFQEWTDTVPSLKPWK
FT                   DVALALAQQEWPKLYDAKALENSQATGAAAVYANDVFVPVDYSLETAQHLPGVQLFITS
FT                   QHEHNGLRASSGAVLKHLFDLTHGREVR"
     gtggttgggg tggtgtccac ccctgcgcgt aacctgggaa gcatgactaa aacacttggt        60
     tcccttcagc tggaagaaat cacgctgacc ctccctctga ctgaagatgt ggccgatgaa       120
     cgcaccattg atgtgttcgc acgcattgcc acacgcgtcg gtggggaaga ccttccgtat       180
     ttagtattcc tgcagggtgg gcctggcaat gaagctccac gtccaagcct taatcccctc       240
     aaccccaatt ggttgggcgt ggccttggag gaataccgcg tggtcatgtt ggatcaacgt       300
     ggcaccggcc gttccacccc agtgggtaat gatattttgg aaaaacccac agcagaagta       360
     gtggagtact tatcccacct gcgcgcagat ggcattgtgc gagatgctga agccctgcgt       420
     aagcatttgg gtgtgaatca gtggaacctt ttaggccagt ccttcggagg tttcaccacc       480
     ctgcattact tgtcccggca cgccgattcc ttggacaacg tgtttattac cggcggtctc       540
     agcgctattg atcgcccagc agaagacgtg tatgccaact gttacaaccg catgcgccga       600
     aactctgagg aattctacgg ccgcttcccg caattacggg aaactttccg agggttggtt       660
     aatcgtgctc gcgccgggga gattgtgctt cccaccggcg aagttgtgtc agaaacccgg       720
     ctgcgatccc ttggtcactt gttgggtagc aatgacggct ggtttgatct gtacaacctg       780
     ctggaattag atcccacctc caacgctttt gtccatgacc tggcaggact tttgcctttc       840
     ggcaaccgca acccaattta ttacgtgctc catgagtcct cttacgccga cggtgtggtg       900
     acaaattggg cagcagagcg tgtgcttcca gaggatttcc gcgaggatcc aacactgctc       960
     accggtgagc acgtgttcca ggagtggaca gacaccgtgc cttcgctcaa gccatggaag      1020
     gacgttgccc tggcattggc tcagcaggaa tggcccaagc tttatgatgc gaaggcattg      1080
     gaaaactcac aggccacggg tgctgcagca gtgtatgcca atgacgtttt cgtgcccgtg      1140
     gattactcct tagaaaccgc acagcacctg cccggtgtgc agctgtttat caccagccag      1200
     catgaacaca atggacttcg tgccagctca ggtgccgtac tcaagcacct tttcgatctc      1260
     acacatggcc gagaggtacg ctga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page