(data stored in ACNUC30630 zone)

EMBL: AP009044.PE76

AP009044.PE76        Location/Qualifiers
FT   CDS_pept        complement(84235..84981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53033"
FT                   /db_xref="GOA:A4Q9Z0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z0"
FT                   /protein_id="BAF53033.1"
FT                   /translation="MTATLIITLFLSLFIGISLGLLGGGGSILTVPILTYVAGLEPREA
FT                   IAASLFVVGTTSLVSAISHARNGRVRWKTGLLFGAAGMVGAFGGGLLGGYIPGTILMIA
FT                   FALMMIATSTAMLRGRKEKKGASKSSLWRVLVDGLVVGAVTGLVGAGGGFLVVPALALL
FT                   GGLSMPVAVGTSLVVITMKSFAGLAGYLTSVQLDWGLVLMVTAAAIVGSLAGSRLAGRV
FT                   PETLLRKGFGVFVLVMGVFVLGLELL"
     atgaccgcca ctttgataat cacgttgttt ctgtcacttt ttatcggcat ttcgctagga        60
     ctgttgggcg gtggtggttc gatcctcact gttccgattc tgacgtatgt ggcgggtttg       120
     gagcctcgtg aagctatcgc cgcctcgctg tttgttgtgg gcacaacgtc gctggtcagt       180
     gccattagtc acgcaagaaa tgggcgggtt cggtggaaaa ctggactgct gtttggcgct       240
     gcgggcatgg ttggcgcgtt tggcggtggc cttctcggtg gctacattcc tggcacaatt       300
     ttgatgatcg cgtttgcgct catgatgatc gccacgtcta ctgcgatgtt gcgggggcgt       360
     aaggagaaga agggggcgtc gaaaagctct ctttggcgcg tccttgttga tggcctggtg       420
     gtcggcgcgg tgaccgggct tgttggtgcg ggcggcggct ttttggtcgt gccagcgctg       480
     gcgctgctcg gcgggctgtc gatgccggtg gctgtgggta cgtcattggt ggtgatcacg       540
     atgaagtcgt ttgcggggct tgccgggtat ctgaccagcg tgcagttgga ttgggggctg       600
     gtgctgatgg taactgcggc cgccatcgtc ggttcgcttg ccggttcgcg ccttgcgggg       660
     cgcgtgcctg agactttgct ccgcaaaggg ttcggcgtgt tcgtactggt catgggcgtg       720
     ttcgtgctcg gcttagagct tttataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page