(data stored in ACNUC30630 zone)

EMBL: AP009044.PE769

AP009044.PE769       Location/Qualifiers
FT   CDS_pept        complement(783997..784917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0724"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53695"
FT                   /db_xref="GOA:A4QBU8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU8"
FT                   /protein_id="BAF53695.1"
FT                   /translation="MAIIKGMNKQSAAVLMVMGSALSLQFGAAIGTQLFPLIGPWSVTS
FT                   LRLFIAGLIMCLVIRPRLRSWTKKQWIAVLLLGLSLGGMNSLFYASIELIPLGTAVTIE
FT                   FLGPLIFSAVLARTLKNGLCVALAFLGMALLGIDSLSGETLDPLGVIFAAVAGIFWVCY
FT                   ILASKKIGQLIPGTSGLAVALIIGAVAVFPLGATHMGPIFQTPTLLILALGTALLGSLI
FT                   PYSLELSALRRLPAPIFSILLSLEPAFAAAVGWILLDQTPTALKWAAIILVIAASIGVT
FT                   WEPKKMLVDAPLHLKTQREEASTHT"
     ttggcaataa tcaagggcat gaataaacag tccgctgcag tgttgatggt gatgggttcc        60
     gccctatccc tgcaatttgg tgctgccatt ggaacgcagc ttttccccct catcggcccc       120
     tggtctgtca cctctttaag gctgttcatc gcaggcttga tcatgtgcct ggtgatccga       180
     ccgcgacttc gttcctggac taaaaaacaa tggatcgccg tgctgctgtt gggattatct       240
     cttggcggaa tgaacagcct gttttacgca tccatcgaac tcatcccgct gggtaccgcc       300
     gtgaccattg agttcctcgg ccccctgatt ttctccgcgg tgttagcccg cacgctgaaa       360
     aacggattgt gcgtggcttt agcgtttctc ggcatggcac tgctgggtat cgattccctc       420
     agcggcgaaa cccttgaccc actcggcgtc attttcgcag ccgtcgcagg aatcttctgg       480
     gtgtgctaca tcctggcatc aaagaaaatc ggccaactca tccccggaac aagcggcctg       540
     gccgtcgcac tgattatcgg cgcagtggca gtatttccgc tgggtgccac acacatgggc       600
     ccgattttcc agaccccaac cctactcatc ctggcgcttg gcacagcact tctcgggtcg       660
     cttatcccct attcgctgga attatcggca ctgcgccgac tccccgcccc cattttcagc       720
     attctgctca gcctcgaacc ggcattcgcc gccgccgtcg gctggatcct gcttgatcaa       780
     acccccaccg cgctcaagtg ggccgcgatc atccttgtca tcgcggccag catcggcgtc       840
     acgtgggagc ctaaaaagat gcttgtcgac gcgcccctcc acttaaaaac gcaacgcgaa       900
     gaggcgagta cacacaccta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page