(data stored in ACNUC30630 zone)

EMBL: AP009044.PE82

AP009044.PE82        Location/Qualifiers
FT   CDS_pept        88587..89300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53039"
FT                   /db_xref="GOA:A4Q9Z6"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z6"
FT                   /protein_id="BAF53039.1"
FT                   /translation="MLSDLSSIFDFQDLSGTFSVVDVLITLVLSFVLTSIVGVVYQKTH
FT                   RHISYSQSFVQTLVLVGMVIAIIMLVVGSNIARAFALVGALSVIRFRNAVKETRDVGFL
FT                   FLAMAIGMTCGTRFYVLAIAATIVVCGVLFIMYRFDWFKADIQRQVIKVQVPADGQADS
FT                   GRSYAEEVELILAQYCTSFEMMSAESVRGGALTEFSYTAQMRKNVKPHELVAKMRDVNY
FT                   GQKATVLTGHDQTDV"
     atgttgagcg atctgagctc catttttgac ttccaagacc tctccggcac cttctctgtc        60
     gtcgacgttc tcatcacttt ggtcttgtcc ttcgtcctga cctccatcgt gggtgtggtg       120
     taccaaaaga cccaccgcca tatctcctac agtcagtcat ttgtgcagac gctggtgctg       180
     gttggcatgg tcatcgcgat catcatgctg gttgttggct ctaacattgc ccgcgcattc       240
     gccctggttg gcgcgctttc ggtgatccga ttccgtaatg cagtgaaaga aacccgtgac       300
     gtcggattcc tcttcctcgc gatggccatc ggcatgacct gtggtacccg cttctacgtt       360
     ctggcgatcg ctgcaaccat cgttgtctgt ggcgttctgt tcatcatgta ccgcttcgac       420
     tggttcaagg ctgatatcca gcgccaggtc atcaaggtgc aggtcccagc cgatggacaa       480
     gctgattccg gcaggtccta cgcagaagaa gttgaactga tcctcgcaca gtactgtact       540
     tcctttgaga tgatgtccgc tgaatctgtc cgcggcggag ccctgacaga gttctcctac       600
     accgctcaaa tgcgcaagaa cgtgaagcca catgagctgg tagccaagat gcgcgatgtg       660
     aactacggcc aaaaagctac cgttctcacc ggccacgatc agacggatgt ttaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page