(data stored in ACNUC30630 zone)

EMBL: AP009044.PE97

AP009044.PE97        Location/Qualifiers
FT   CDS_pept        104161..104400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53054"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA11"
FT                   /protein_id="BAF53054.1"
FT                   /translation="MNDDLQMAMILADTPIFHPNTGKPFDGEHKLSPSARAGLEAPRYC
FT                   QLCGRRMKVQVRPDGWDALCSRHGFVDSSYLGRR"
     atgaacgacg atctccaaat ggccatgatt ctggcagaca ccccgatctt tcatccaaac        60
     accggcaagc ccttcgatgg tgaacataag ctgtcgccct ctgcgcgagc aggtttggaa       120
     gcaccccgtt attgccagct ctgcggtcgg cgcatgaaag tccaagtccg ccccgacggg       180
     tgggacgcct tatgctcccg ccacggtttc gtcgactcct cttatctagg gcgtcgataa       240
//

If you have problems or comments...

PBIL Back to PBIL home page