(data stored in ACNUC30630 zone)

EMBL: AP009256.AAPA

AP009256.AAPA        Location/Qualifiers
FT   CDS_pept        123032..124609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aapA"
FT                   /locus_tag="BAD_0088"
FT                   /product="amino acid permease"
FT                   /note="COG family: gamma-aminobutyrate permease andrelated
FT                   permeases"
FT                   /note="Orthologue of BL0156"
FT                   /note="PFAM_ID: aa_permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38869"
FT                   /db_xref="GOA:A0ZZI6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI6"
FT                   /protein_id="BAF38869.1"
FT                   /translation="MTIMTLGNTNTGKAGTNTQAADASDATQNAQSTQSHIKSVESLDK
FT                   DNDMERGLKNRHVQFIAIGGTIGTGLFLGSGKSIALTGPSIIFVYIGVGLIMFLLMRAI
FT                   GEMMYSDPSQHTFINFITRYLGRAWGKFAGWTYWIVLILTGMTEITAVSTYFVTFFGTF
FT                   GIDLNAWKWLIELCFLVALTGINLIAVKVFGEAEFWFSMIKITLIVGLIVTAVVMLFLG
FT                   FSYPATHIEGVDGTVSGATVSLTNIADGFQLAPNGWMNFFMSFQMVFFAYQLIEFVGVT
FT                   VSETQNPRKVLPKAVNELIMRILIFYVGALVAIMAIVPWRNFHQNADGSFGSPFIMVFK
FT                   YAGLDWAAALVFFVVITAAASALNSLIYSAGRHLYQLAQDSESPAMQRLGEVSDRKVPA
FT                   KAIIVSGCMILFSPLINAIPGVSGAFVLFASAASAVVIFIYILTMLAHRRYRQSADFLP
FT                   DGFVMPAWQVCDWIAVAFYVVVYVTLFLSSDTLGSAVAGLVWFVVFGGYCLLHERFQNR
FT                   DLKAALGK"
     gtgaccatta tgactttagg gaatacgaat accgggaagg ccggcacaaa cacgcaagct        60
     gccgacgcgt ctgacgcaac gcagaacgcg caaagcacac aatcgcatat caaatccgtc       120
     gaaagcctcg acaaagacaa cgacatggaa cgcggcctga aaaatcgcca tgtccaattc       180
     atcgccatcg gcggaaccat cggcactggc ctgttcctcg gctccggcaa atcgattgcg       240
     ctgaccggac caagcatcat cttcgtgtac atcggcgtgg gcctcatcat gttcctgctc       300
     atgcgcgcca tcggcgaaat gatgtacagc gacccaagcc agcacacctt catcaacttc       360
     atcacccgct acctcggccg cgcgtggggc aaattcgccg gctggacgta ctggattgtg       420
     ctcatcctga ccggcatgac cgaaatcacg gccgtcagca cctatttcgt cacgttcttc       480
     ggcacgttcg gcattgacct caacgcgtgg aaatggctta tcgaactgtg cttccttgtg       540
     gcgctcaccg gcatcaatct cattgccgtg aaagtgttcg gcgaggcgga attctggttc       600
     tccatgatca aaatcacgct gattgtgggt ctgattgtca ccgccgtggt gatgctgttc       660
     ctcggtttca gctacccggc cacgcatatc gaaggcgtgg acggcacggt ttccggtgcc       720
     actgtgagcc ttacgaacat tgccgacggc ttccagctcg cgccgaacgg ctggatgaac       780
     ttcttcatga gcttccagat ggtgttcttc gcctaccagc tcatcgaatt cgtgggtgtg       840
     accgtgtccg aaacccagaa cccgcgcaaa gtgctgccga aagccgtcaa cgagctgatc       900
     atgcgcatcc tcatcttcta cgtgggcgcg ctcgtggcca tcatggcgat cgtgccgtgg       960
     cgcaacttcc accagaacgc ggacggctcg ttcggctccc cgttcatcat ggtgtttaag      1020
     tacgcgggcc tcgactgggc tgccgcgctc gtgttcttcg tggtgatcac cgcagccgcg      1080
     tcagcgctta actcgctgat ctactcggct ggacgccatc tgtaccagct cgcgcaggat      1140
     tccgaatcgc ccgccatgca gcgtctcggc gaagtgtcgg accgcaaggt tccggcgaag      1200
     gcgattatcg tgtccggctg catgatcctg ttctccccgc tgatcaacgc gattccgggc      1260
     gtttccggcg cgttcgtgct gttcgcctcg gccgccagcg ccgtcgtgat cttcatttac      1320
     attctgacga tgcttgctca ccgccgctac cgtcaaagcg ccgactttct gccggacggc      1380
     ttcgtgatgc cggcctggca ggtgtgcgat tggattgcgg tcgcgttcta cgtggtcgtg      1440
     tatgtcacgt tgttcctgtc ttccgacacg ctcggttccg cagtcgccgg cctggtctgg      1500
     tttgtcgtgt tcggtggcta ctgcctgctg cacgagcggt tccagaaccg cgacctgaag      1560
     gcggctctag ggaagtag                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page