(data stored in ACNUC30630 zone)

EMBL: AP009256.CLPP2

AP009256.CLPP2       Location/Qualifiers
FT   CDS_pept        736252..736953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP2"
FT                   /locus_tag="BAD_0588"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 1"
FT                   /note="Hydrolyzes proteins to small peptides with theATPase
FT                   subunits ClpA or ClpX_ ClpP degrades specificsubstrates"
FT                   /note="Orthologue of BL0944"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39369"
FT                   /db_xref="GOA:A1A0Y6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y6"
FT                   /protein_id="BAF39369.1"
FT                   /translation="MASEEAQFVARAERLAGPTGVVGFQGAAAREAAFAPQNRYVLPQF
FT                   EEKTPYGYKRQDPYTRLFEDRIIFMGVQVDDTSADDIMAQLLVLESQDPNRDVMMYINS
FT                   PGGSMTAMTAIYDTMQYIKPDVQTVCLGQAASAAAILLAAGAKGKRLMLPNARVLIHQP
FT                   AIDQGFGKATEIEIQAKEMLRMREWLENTLAKHTGRDIEKIRKDIEVDTFLTAQEAKEY
FT                   GIVDEVLEHRS"
     atggcaagcg aagaagcaca gtttgtagcc cgcgccgaac gtctggccgg accgaccggt        60
     gtggtcggct tccagggggc tgcggcgcgt gaggccgcgt tcgcaccgca gaaccgttac       120
     gttctgccgc agttcgagga aaagaccccg tacggataca agaggcagga tccgtacacc       180
     cgcctgttcg aggatcgcat catcttcatg ggcgtgcagg tggacgacac ctccgccgat       240
     gacatcatgg cccagctgct ggttttggaa agtcaggatc cgaaccgtga cgtgatgatg       300
     tacatcaatt cgccgggcgg ttccatgacg gccatgaccg ccatctacga caccatgcag       360
     tacatcaagc cggacgtgca gaccgtatgc ctcggccagg ccgcctcggc cgcggccatc       420
     ctgctggccg ccggcgccaa aggcaaacgt ctgatgctgc cgaacgcccg cgtgctcatc       480
     caccagccgg ccatcgacca gggcttcggc aaggccacgg agattgaaat ccaggccaag       540
     gagatgctgc gtatgcgtga atggctggag aacacgctgg ccaagcatac cggtcgtgac       600
     atcgagaaga tccgcaagga catcgaagtg gacacgttcc tgacggccca ggaggccaag       660
     gaatacggca tcgttgacga ggtgctggaa catcgcagct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page