(data stored in ACNUC30630 zone)

EMBL: AP009256.CPXR

AP009256.CPXR        Location/Qualifiers
FT   CDS_pept        523898..524215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="BAD_0417"
FT                   /product="two component system response regulatory protein"
FT                   /note="Escherichia coli ECs4838 transcriptional regulator
FT                   in 2-component system CpxR"
FT                   /note="Orthologue of YPTB0070"
FT                   /note="Similar to Yersinia pestis YPO0074 cpxR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39198"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G5"
FT                   /protein_id="BAF39198.1"
FT                   /translation="MRWYRTVRRSPWSERQPSAVSNAPSSAVMCGLNITKMRPPKSSST
FT                   KAMMRLGTPIILAAMPTQPLRCASNVSFRSCATARSSSVFSAAADGWLKNGMDVIISRC
FT                   M"
     atgcgctggt atcggacggt gcggcgctcg ccctggagcg agaggcaacc ttccgccgta        60
     tcgaacgcgc cgtcttcggc ggtgatgtgt ggattgaaca tcacgaaaat gcggccgccg       120
     aaatcctcat ccacaaaagc gatgatgcgc ttgggaacgc cgatcatatt ggccgccatg       180
     cccacgcaac cattgcgatg cgcgtccaac gtgtctttca ggtcctgtgc cacggccaga       240
     tcctcttcgg tgttctcggc tgcggcggac ggctggctca aaaatgggat ggacgtcata       300
     atctcacgtt gcatgtga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page