(data stored in ACNUC30630 zone)

EMBL: AP009256.DNAN

AP009256.DNAN        Location/Qualifiers
FT   CDS_pept        1997..3121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BAD_0002"
FT                   /product="DNA polymerase III, b subunit DnaN"
FT                   /note="Binds the polymerase to DNA and acts as a sliding
FT                   clamp"
FT                   /note="Orthologue of BL0638"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38783"
FT                   /db_xref="GOA:A0ZZA0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA0"
FT                   /protein_id="BAF38783.1"
FT                   /translation="MKVEVNSQALADAVAWTTRVIDARPATPILAGIRLEAIDGTLQLS
FT                   AFNYAISARHHIEAGVDEAGSVLVLGKLLADITKSLPAAKTYLSTDGSTMTITSGKSTF
FT                   TMQLMPESEYPDLPVVPTKLGQVDSPTFAQAVNQASVAVSREENRPVLTGIRVQFQGDK
FT                   VIMSSTDRFRLARSSFTWTPEDATISTTALVRGSLLRDMARSLDEHQNVTIDFDADNPS
FT                   LLGFENAGRVSTSQLIDGEFPAVDRLYADEYPIHAVINKQALIDAIKRVSLVAERNAPI
FT                   RMVFSGQELTLSAGTADEAQAKEILDIDMDGEDITVAFNPSYLVDGLSAISEPFVRMKM
FT                   TTAVKPVEFNGQQEADSDESMDYRYLLVPMRFNN"
     atgaaagtcg aagtcaattc ccaagctctt gccgatgccg tggcatggac cacacgtgtc        60
     atcgacgcac gtcccgcaac cccgattctg gcgggcatcc gtctggaagc cattgacggc       120
     acactccagc tttccgcctt caactacgcc atttccgcac gccaccacat cgaagccggc       180
     gtggacgagg ccggtagcgt tctggtgctg ggcaaactgc ttgccgacat caccaagtcg       240
     ctgcccgctg cgaaaaccta tctttccacc gatggttcca cgatgaccat cacgtcgggc       300
     aagtcgacct tcaccatgca gctcatgccg gaaagcgaat atccggatct gcccgtggtg       360
     ccgacgaaac tgggtcaggt ggactccccc accttcgctc aggccgtcaa ccaggcgtcc       420
     gtcgcggtct cccgtgagga gaaccgtccg gtgctcaccg gcatccgcgt ccagttccag       480
     ggcgacaagg tcatcatgag ctccaccgac cgtttccgtc tggcccgttc cagcttcacc       540
     tggacgccgg aggatgcgac catcagcacc accgctttgg tccgtggctc gctgctgcgc       600
     gacatggcac gttcgctgga cgagcatcag aacgtcacca tcgatttcga tgcggacaac       660
     ccgtccctgc tgggcttcga gaacgccggc cgcgtgtcca cctcccagct catcgacggc       720
     gaattcccgg ccgttgaccg cctgtatgcc gatgaatacc cgattcatgc cgtcatcaac       780
     aagcaggccc tcatcgacgc catcaagcgc gtttcgctgg tcgccgaacg caacgccccg       840
     atccgcatgg tcttctccgg ccaggagctg acgctgtcgg ccggcaccgc cgacgaagca       900
     caggcgaagg agattctcga catcgacatg gacggcgagg acatcaccgt ggcgttcaac       960
     ccctcctatc tggtcgacgg cctgagcgcc atcagcgagc cgttcgtgcg catgaagatg      1020
     accaccgcgg tcaagcccgt ggaattcaac ggccagcagg aagcggattc cgacgaatcc      1080
     atggactacc gttacctgct cgttccgatg cgcttcaaca actga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page