(data stored in ACNUC30630 zone)

EMBL: AP009256.FFH

AP009256.FFH         Location/Qualifiers
FT   CDS_pept        complement(280400..282049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BAD_0211"
FT                   /product="signal recognition particle protein"
FT                   /note="Identified by sequence similarity"
FT                   /note="Orthologue of Lxx14950_BL0303"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38992"
FT                   /db_xref="GOA:A0ZZV9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZV9"
FT                   /protein_id="BAF38992.1"
FT                   /translation="MAAFSSLTDRLSNAFKHLKSKGKLSEADIDGTIREIRRALLDADV
FT                   ALDVVRSFTSRIRERALGTEVSEALNPAQQVVKIVNEELTAVLGAGVDRPLNFAKNPPT
FT                   IIMLAGLQGAGKTTLAGKLGYWLKDSGHTPLLVAADLQRPNAVTQLQVVGERAGVPVYA
FT                   PEKGVQSDGGEAVVSPGQTTGDPVKVARDAVELAKQKLYDTVIIDTAGRLGVDEELMKQ
FT                   ARDIRDAVQPNEILFVIDAMIGQDAVQTAKAFDEGVDFTGVVLSKLDGDARGGAALSVA
FT                   SVTGKPILFASTGEGLKDFEVFHPDRMASRILDMGDILTLIEQAQKQFDEEEARKAAVK
FT                   ISDGSFGLDDFLDQLQQVRKLGPMKNLLGMIPGMAAHRKELEQFDEREIDRTEAIIRSM
FT                   TPAERRDPSIIDGSRRARIAYGSGVTVSQVNALLQRFDQAAKMMRRMSNKVGAGVPGFG
FT                   GPAMGGGKGKGKGKKNKKKSGKSGNPMKREAEEKALRDKLAGKASDGASSGGSAFAKKP
FT                   QNPALPAGLQDMLGDSGELPPNLGGGLSGLLH"
     atggcagcat ttagttcttt gacagaccgg ctctcgaatg cgttcaagca tctgaagagc        60
     aagggcaagc tttccgaggc tgatatcgac ggtaccatcc gcgagatccg ccgcgcgctg       120
     ctcgacgccg atgtggcgct cgacgtggtg cgttccttca ccagccgcat ccgcgaacgc       180
     gcgctcggca ccgaggtttc cgaagcgctc aacccggcgc agcaagtggt gaagatcgtc       240
     aacgaggaac tcaccgcggt gcttggcgcc ggtgtggacc gcccgttgaa cttcgcaaag       300
     aatccgccga cgatcatcat gctcgccggc cttcagggcg ccggtaagac gacgctcgcc       360
     ggcaagctgg gctactggct gaaggattcc ggccacaccc cgctgctcgt ggcggccgat       420
     ctgcagcgtc cgaacgcggt gacgcagctg caggtggtcg gcgaacgcgc cggcgtgccg       480
     gtgtacgcgc cggagaaggg cgtgcagtcc gatggcggcg aagcggtcgt ctcccccggc       540
     cagaccaccg gcgacccggt gaaggtggcc cgtgacgccg tggagctcgc caagcagaag       600
     ctttacgaca cggtgatcat cgataccgca ggccgtctcg gcgtggatga ggagctgatg       660
     aagcaggctc gcgacatccg cgatgccgtg cagccgaacg agattctgtt cgtcatcgac       720
     gcgatgatcg gccaggacgc cgtgcagacg gccaaggcgt tcgacgaggg cgtggatttc       780
     accggcgtgg tgctgtccaa gctcgatggc gacgcccgtg gtggcgccgc gctgtccgtg       840
     gcatccgtga ccggcaagcc gatcctgttc gcctccaccg gcgaaggatt gaaggatttc       900
     gaggtcttcc atccggaccg catggcgtcc cgcatcctcg acatgggcga tattctcacc       960
     ctgatcgagc aggcgcagaa gcagttcgac gaggaagagg cccgcaaggc cgccgtcaag      1020
     atctccgacg gttccttcgg ccttgacgat ttcctcgacc aacttcagca ggtgcgcaaa      1080
     ctcggcccga tgaaaaacct gcttggcatg attccgggca tggccgcgca tcgtaaggaa      1140
     cttgagcagt tcgacgagag ggaaatcgac cgcaccgagg ccatcatccg ttcgatgact      1200
     ccggccgagc gtcgcgatcc ctcgatcatc gacggttccc gccgcgcccg catcgcctac      1260
     ggttccggcg tgacggtttc gcaggtcaac gcgctgctgc agcgcttcga ccaggccgcg      1320
     aagatgatgc gccgcatgag caacaaggtc ggcgccggcg tgcccggctt cggaggcccc      1380
     gcgatgggcg gcggcaaagg caagggcaaa ggcaagaaga acaagaagaa gtcgggcaag      1440
     tccggcaatc cgatgaagcg tgaagccgag gagaaggcat tgcgcgacaa gctcgccggc      1500
     aaggcttccg acggcgcttc gtcaggtggc tccgcgttcg ccaagaagcc gcagaatccg      1560
     gcgcttcctg ccggattgca ggatatgctg ggcgattccg gcgagctgcc gccgaactta      1620
     ggtggcggtc tgtccggtct gctgcactaa                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page