(data stored in ACNUC30630 zone)

EMBL: AP009256.FTSE

AP009256.FTSE        Location/Qualifiers
FT   CDS_pept        582216..583454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="BAD_0464"
FT                   /product="FtsE-like ATP binding protein in cell division"
FT                   /note="COG family: predicted ATPase involved in
FT                   celldivision"
FT                   /note="Orthologue of BL1183"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39245"
FT                   /db_xref="GOA:A1A0L2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L2"
FT                   /protein_id="BAF39245.1"
FT                   /translation="MALISLEHVSKVYPKGTRPALDDISLDIDRGDFVFLVGASGSGKT
FT                   TLLSLLLREEEATDGEIRVAGNDLRRLSARQVPHYRRQIGFIFQDYKLLNNKTVWENVA
FT                   FALEVIGTSRSTIKSLVPKVLQTVGLTGKENNYPHELSGGEAQRVAIARAYVNHPQILL
FT                   ADEPTGNLDPTTSLGIMEVLDAINRTGTTIVMATHNEEIVNSMRKRVVELHTGKIVRDE
FT                   QQGSYDSALYFPDAEVESKSHQALGTSDPNAKYRRQNAIDSTNAPDDTVDVEGATRAET
FT                   VVNAVDVVAAAVHDGQGNDGIARLAKSVHSGRTGRYGEAFASVETTLTWGKGLSLEQMA
FT                   DQEQAEQTERNEQAKTSAENDASETGADEASALSAPPAPPVPPTQTEPPTPPEPPVPPA
FT                   PSDENPEDTKEHD"
     atggcgctga tctcgcttga acatgtgagc aaagtctatc caaagggcac gcgtcccgca        60
     ttggatgaca tcagtcttga catcgatcga ggtgatttcg tctttcttgt gggcgcgtcc       120
     ggttccggca agaccacctt gctgagcctg ctgcttcgcg aggaggaagc cacggatggc       180
     gagatccgcg tcgccggcaa cgatctgcga cgcctgtccg cacggcaggt gccgcattat       240
     cgccggcaga tcggctttat cttccaggat tacaagctgc tcaacaacaa gacggtatgg       300
     gagaacgtcg ccttcgcact tgaagtgatc ggcacaagcc gttccaccat caaatcgctg       360
     gtgcccaaag tactgcagac ggtggggctc acgggcaagg aaaacaacta cccccatgag       420
     ctgtccggcg gcgaagcgca acgcgtcgcc atcgcaaggg cgtatgtgaa ccatcctcag       480
     atcctgctcg ccgacgagcc tacgggcaac ctcgacccga ccacatcgct gggcatcatg       540
     gaagtgttgg acgccatcaa ccgtaccggc accaccatcg tcatggccac acacaacgaa       600
     gagatcgtca actccatgcg caaacgcgtg gtcgaattgc acaccggcaa gattgtgcgc       660
     gacgagcagc agggatccta cgattccgcg ctgtatttcc cggatgccga agtcgagtcg       720
     aaatcgcacc aggcattggg cacttccgac ccgaacgcga aataccgtcg acagaacgcc       780
     atcgattcaa cgaacgctcc tgacgacacc gtcgacgtgg aaggcgcgac gcgcgccgaa       840
     accgtggtga acgccgtgga tgtggtcgcc gctgccgtcc atgacggaca ggggaacgac       900
     ggcatcgccc gtcttgccaa atccgtgcat tccggacgca ccggccgtta cggcgaggcc       960
     ttcgcgtcag tggagaccac cttgacctgg ggcaagggac tgagcctcga acagatggcc      1020
     gaccaggaac aggccgagca aaccgaacgg aacgaacagg ccaagacctc cgctgaaaat      1080
     gatgcctccg agactggtgc cgacgaagca tcggcgctgt ccgctccgcc tgcaccgccc      1140
     gttccaccga cccaaaccga gcctccgaca ccgcccgaac cgcccgtccc gccggcaccg      1200
     tccgatgaaa accctgagga caccaaggag cacgactga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page