(data stored in ACNUC30630 zone)

EMBL: AP009256.FTSX

AP009256.FTSX        Location/Qualifiers
FT   CDS_pept        583451..584377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="BAD_0465"
FT                   /product="FtsX-like protein in cell division"
FT                   /note="COG family: cell division protein"
FT                   /note="Orthologue of BL1182"
FT                   /note="PFAM_ID:DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39246"
FT                   /db_xref="GOA:A1A0L3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L3"
FT                   /protein_id="BAF39246.1"
FT                   /translation="MMRFRFILSETWNSLKRNVSMIISVMLVTFISFLFIGVSGLMQAQ
FT                   ITAAKGEWYDKVEVVVWLCPDGASQAASCSSGKAPSNQEIVDLENVINEEAGNIVSKIT
FT                   YVSREDFYKNTFLKQYPNGEYQGRVLTAADMQGSLRLKLKDPTKYQVVSEVLSGRTGVE
FT                   EVQDQRKIFDPVFSVLNRATAVTVALAGVMILVAIMLTGTTIRMSAASRKNETEIMRLV
FT                   GASNWTIRLPFVLEGVFASLIGSLLACGTLSAMVKLFITDWLSKSVQWMPLINQKTVWL
FT                   LAPALVVGAVVLSIVASSISLRKYLKA"
     ctgatgcgtt ttcgtttcat cctttccgaa acatggaaca gcctcaagcg caatgtttca        60
     atgatcatct ccgtcatgct ggtcacattc atctccttcc tgttcatcgg cgtatccggc       120
     ctgatgcagg cacagatcac cgccgcgaag ggcgaatggt acgacaaggt cgaagtggtc       180
     gtatggctgt gcccggacgg tgccagccag gcggcgtcct gctcgtcggg caaggcgcct       240
     tccaaccagg agatcgtcga tctggagaac gtgatcaacg aggaagccgg caacatcgtc       300
     tccaaaatca catatgtgag ccgtgaggac ttctacaaga acaccttcct caagcagtat       360
     ccgaacggcg aataccaagg acgcgtgctc accgccgccg acatgcaggg gtcgctgcgt       420
     ctgaaactga aggacccgac caaataccaa gtggtatccg aagtgttgag cggccgcacc       480
     ggtgtcgagg aagtgcagga tcaacgcaag atcttcgacc cggtcttctc ggtgctgaac       540
     cgtgcgacgg cggtcaccgt ggcgctcgcc ggcgtgatga tcctggtggc catcatgctg       600
     accggcacga cgattcgcat gagtgccgcc tcgcgtaaga acgagaccga gatcatgcga       660
     ctggtgggag cctcgaactg gaccatccgc ctgccgttcg tgttggaagg cgtgtttgcg       720
     tcgctgattg gttcgctgct cgcctgcgga acgttgagcg ccatggtgaa gctgttcatc       780
     acggattggc tgtcgaagag cgtgcagtgg atgcctctga tcaaccagaa gacggtatgg       840
     ctgcttgcac cggcccttgt ggtgggagcc gtcgtgctgt cgatcgtcgc gtccagcatc       900
     tcgctgagga agtacctgaa ggcataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page