(data stored in ACNUC30630 zone)

EMBL: AP009256.GLUD

AP009256.GLUD        Location/Qualifiers
FT   CDS_pept        727602..728729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluD"
FT                   /locus_tag="BAD_0582"
FT                   /product="permease protein of ABC transporter for
FT                   glutamate"
FT                   /note="COG family: ABC-type amino acid transportsystem_
FT                   permease component"
FT                   /note="Orthologue of BL0024"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39363"
FT                   /db_xref="GOA:A1A0Y0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y0"
FT                   /protein_id="BAF39363.1"
FT                   /translation="MASNESAVLFDQPGPKGRKTIRIVNWIAGIIFAVVVVLILMRLHN
FT                   PPDGENQLSWELWKPALDAEAWTDFYLPGLWATIRASVLAVVGAVVFGLVFGVGRLLPS
FT                   LLIRTISGAIVEFARAVPVLLLMIFFWRWFAFAGLPSPAYWAVVLALVIYNGSVVAELV
FT                   RSGVGNLPNGQREASLALGLTRTQSLLQIEVPQAIYAMLPAAVTQLVVVLKDTALGSII
FT                   MYTDLLQESRRLGSMYFNILQTLVVAAVVYFIVCWLLSRLAEWLPSRMQQHTAAPAEPE
FT                   PVAPIAIMDPSNVNQIAVAKEGVPLGGAQRVYHVHHRGTNASIHQWRQTRYAQGFDETH
FT                   PESQVKFDKNGHPIKDNPFKTKGDGKDKNKSEADE"
     atggcaagca atgaaagcgc ggtgctgttc gaccagcctg gtccgaaggg ccgcaaaacc        60
     atccgtatcg tcaattggat cgcaggcatc atcttcgcgg tggtggtcgt gctgatcctc       120
     atgcgtctgc acaatccgcc ggacggcgag aaccagctga gctgggaact gtggaaaccg       180
     gcgcttgacg ccgaagcatg gaccgacttc tatctgccgg gactgtgggc cacgatccgc       240
     gcgtccgtac tggccgtggt cggagccgtg gtgttcggcc tggtctttgg tgtgggccga       300
     ctgctgccga gcctgctgat ccgtaccatt tccggcgcga tcgtggaatt cgcacgagcc       360
     gtccccgttc tgctgctcat gatcttcttc tggcgctggt tcgccttcgc aggtctgccc       420
     agccccgcgt attgggcggt ggtgctcgcg cttgtgatct acaacggatc cgtggtggcc       480
     gagctggtgc gttccggcgt gggcaacctg ccgaacggcc agcgtgaggc ctcgctcgcc       540
     ttgggattga cccgcacgca gtcgctgttg cagatcgaag tgccgcaggc catctacgcc       600
     atgctgccgg cggccgtgac ccagctggtc gtcgtgttga aggacaccgc gctcggctcg       660
     atcatcatgt acactgacct gctgcaggaa tcacgtcgac tcggctccat gtatttcaac       720
     atcctacaga cgctggtggt ggccgcggtc gtctatttca tcgtctgctg gctgctaagc       780
     agactggccg aatggctgcc gtcgcgcatg cagcagcata cggctgcacc ggccgaaccg       840
     gaaccggtcg cgccgatcgc catcatggat ccgtcgaacg tgaaccagat cgccgtggcc       900
     aaggaaggcg tgccgctggg tggcgcgcag cgtgtctacc atgtgcacca tcgcggcacc       960
     aacgcgtcca tccaccagtg gcgtcagacc aggtacgccc aaggcttcga tgagacgcat      1020
     ccggaaagcc aggtcaaatt cgacaagaat ggacatccga tcaaggacaa tccgttcaag      1080
     acgaagggcg atggcaagga caagaacaag tccgaagccg acgaatag                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page