(data stored in ACNUC30630 zone)

EMBL: AP009256.GYRA

AP009256.GYRA        Location/Qualifiers
FT   CDS_pept        7411..10071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BAD_0006"
FT                   /product="DNA gyrase (topoisomerase II) A subunit"
FT                   /note="COG0188"
FT                   /note="Orthologue of MT0006_BL0634"
FT                   /note="negatively supercoils closed circulardouble-stranded
FT                   DNA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38787"
FT                   /db_xref="GOA:A0ZZA4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA4"
FT                   /protein_id="BAF38787.1"
FT                   /translation="MEPLSPQEADNTDYGLMVGERVQKKDLQQEMRESYLAYAMSVIVD
FT                   RALPDVRDGMKPVHRRVIYAMYDGGYRPDRGYSKCARVVGEVMGKYHPHGDSAIYDTLV
FT                   RMAQSWSMRYTLVDGQGNFGSPGDDPAAAMRYTECRMAPLAMEMVRDIDKDTVDFLPNY
FT                   DGKTQEPTVLPARFPNLLCNGSSGIAVGMATNIPPHNMREVAEGVHWALDHPDASREEL
FT                   LDNLIRIIKGPDFPTGATILGHKGIEQAYRTGRGLITMRAVVNTEEIKGRMCLVITELP
FT                   YQVNPDRLVVSIREAVRDGKIQGIADMRDETSGRTGQRLVLVLKRDAVPKVVLNNLYKH
FT                   SQLQQTFGANMLALVDGVPRTLSLDAFIRHWVNHQLEVIARRTAYLKREAEERDHILQG
FT                   YLKALDMIDEVIALIRASESAETARTGLMDLLDVDEVQADAILAMQLRRLAALERQKIL
FT                   DEHNELMRKIADYNDILAKPERQRKIVGDELDEIVAKYGDERRTKILPYSGEMNVEDLI
FT                   AEENVVVTVTHSGFIKRTKADEYRAQHRGGKGIKGAKLREDDVVDHFFLTSTHNWLLFF
FT                   TNKGRVYRLKAYELPEGSRDSKGQHVANLLQFGPDETIQTVLSIPNYDVAKYLVLATRS
FT                   GKVKKTALAEYDSPRQGGLIAVRLMTDENGENADELIGAALCNADDDIILVSKQGMSLK
FT                   FEANDEQLRPMGRQTAGVQGMKFRDGDELLAMDVVQGDSDRDLLVVTNEGFAKRTAISE
FT                   YRLQGRNGYGVKAVQLAEGRGSLVGAVIVEESDQIMAIMKSGKVIRSNVAEVKRTGRTT
FT                   QGVTLAKPDKNDEIISIARNEETDEDDAEQAAAENGAVQNDAAAQSQAETTTENSAETG
FT                   TEATSDAGDGENVEA"
     atggaaccgt tgagcccgca ggaggccgac aacaccgatt atggcctgat ggtcggcgaa        60
     cgcgtccaga agaaggatct gcagcaggaa atgcgcgaat cctatctggc gtacgccatg       120
     tccgtcatcg tcgatcgtgc ccttccggac gtgcgagacg gcatgaagcc ggtgcaccgc       180
     cgcgtgatct acgcgatgta cgacggcggc taccgccctg accgcggcta ctccaagtgc       240
     gcacgcgtcg tcggcgaagt catgggcaag taccatccgc acggcgattc cgccatctac       300
     gacacgttgg tgcgtatggc gcagtcgtgg tcgatgcgat acacgctcgt cgacggccag       360
     ggcaacttcg gctcccccgg cgacgacccg gcagccgcaa tgcgttacac ggaatgccgt       420
     atggcgccgc tcgccatgga aatggtgcgt gacatcgaca aggacaccgt cgatttcctg       480
     ccgaactacg atggcaagac gcaggagccg accgtgctgc cggcccgctt cccgaacctg       540
     ctgtgcaacg gctcgtccgg catcgccgtc ggcatggcga ccaacattcc tccgcacaac       600
     atgcgcgagg tggcagaagg cgtgcattgg gcgctcgacc atccggacgc gagccgtgag       660
     gaactgctcg acaacctgat ccgcatcatc aagggaccgg acttccctac cggcgccacg       720
     attctcggcc ataagggcat cgaacaggcg taccgtaccg gccgtggcct catcaccatg       780
     cgagccgtgg tgaacaccga ggagatcaag ggccgcatgt gcctcgtgat caccgaactg       840
     ccgtaccagg tcaacccgga tcgtctggtc gtgtccatcc gcgaagcggt gcgcgacggc       900
     aagatccaag gcatcgccga catgcgcgac gaaacctccg gccgtactgg ccagcgcctc       960
     gtgctcgtgc tcaagcgcga cgccgtgccg aaggtcgtgc tcaacaacct gtacaagcat      1020
     tcccagctgc agcagacctt cggcgcgaac atgctggcac tggtcgacgg tgtgccgcgc      1080
     acgctgtccc tggatgcgtt catccgtcat tgggtaaacc accagctcga agtcatcgca      1140
     cgccgtaccg cctacctcaa gcgcgaggcc gaggaacgcg accacatcct gcagggctat      1200
     ctgaaggccc ttgacatgat cgatgaggtc atcgccctca tccgtgcctc cgagtccgcg      1260
     gagaccgccc gcacgggcct tatggacctg cttgacgtgg acgaggtgca ggccgacgcc      1320
     atcctcgcca tgcagctgcg ccgactggcc gccctggaac gtcagaagat cctcgacgag      1380
     cacaacgagc tcatgcgcaa gatcgccgac tacaacgaca tcctcgccaa gccggaacgc      1440
     cagcgcaaga tcgtcggcga cgagctggac gaaatcgtcg ccaagtatgg cgacgaacgc      1500
     cgtaccaaga ttctgccgta ctccggcgag atgaacgtcg aagacctgat cgccgaagaa      1560
     aacgtggtcg tcaccgtgac ccactccggt ttcatcaagc gcaccaaggc cgacgaatac      1620
     cgcgcgcagc accgcggcgg caagggcatc aagggcgcca agctgcgcga ggacgacgtg      1680
     gtggaccact tcttcctgac cagcacgcac aactggctgc tgttcttcac caacaagggc      1740
     cgcgtgtacc gtctgaaagc atacgagctg ccggaaggct cccgcgattc caagggacag      1800
     cacgtggcga acctgctgca gttcggcccg gacgagacga tccagaccgt gctgtcgatt      1860
     ccgaactacg acgtggccaa gtacttggtg ctcgccaccc gttccggcaa ggtcaagaag      1920
     accgcgctcg ccgaatacga ctccccgcgt cagggtggtc tgatcgcggt acgactcatg      1980
     accgacgaga acggcgagaa cgccgacgag ctgatcggtg ccgcgctgtg caacgccgac      2040
     gacgacatca tcctcgtctc caagcagggc atgagcctga agttcgaagc caacgacgag      2100
     cagctgcgcc cgatgggccg ccagaccgcc ggtgtgcagg gcatgaagtt ccgcgacggc      2160
     gacgagcttt tggccatgga tgtggtgcag ggcgattccg acagggatct gctcgtggtc      2220
     accaacgagg gcttcgccaa gcgcaccgcc atcagcgaat accgtctgca gggccgtaac      2280
     ggctacggcg tcaaggccgt gcagctcgcc gaaggccgtg gctccctggt gggtgccgtg      2340
     atcgtggagg aatccgacca gatcatggcc atcatgaagt ccggcaaggt catccgctcc      2400
     aacgtcgccg aagtcaagcg caccggacgt accacccagg gtgtgacgct cgccaagcct      2460
     gacaagaacg acgaaatcat ctccatagca cgtaacgagg agaccgacga ggatgatgcc      2520
     gagcaggccg ccgcggaaaa cggagcagtc cagaacgacg cagccgcgca atcgcaagcc      2580
     gaaaccacta ctgaaaactc cgctgaaacc ggtacggaag ccacttccga tgccggcgat      2640
     ggcgagaatg tagaggcctg a                                                2661
//

If you have problems or comments...

PBIL Back to PBIL home page