(data stored in ACNUC30630 zone)

EMBL: AP009256.GYRB

AP009256.GYRB        Location/Qualifiers
FT   CDS_pept        5177..7315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BAD_0005"
FT                   /product="DNA gyrase (topoisomerase II) B subunit"
FT                   /note="Decatenates newly replicated chromosomal DNA
FT                   andrelaxes positive and negative DNA supercoiling"
FT                   /note="Orthologue of Rv0005_BL0635"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38786"
FT                   /db_xref="GOA:A0ZZA3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA3"
FT                   /protein_id="BAF38786.1"
FT                   /translation="MAGKMQEGISVADLDADSLNESAENTQEDQIQDQIQNDQLEDAQL
FT                   DDSLSPEHYDASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYA
FT                   SHIEVTILPDGGVRVVDDGRGIPVDEVPGEGISGVETVMTKLHAGGKFGGGGYAVSGGL
FT                   HGVGISVVNALSTRVDIEVRRQGFHWTQTYIDQKPTARLLKGKPMEEGESTGTSVTFWA
FT                   DGKIFETTTYDFEILRNRFQQMAFLNKGLKISLTDLREPDQAGDEVSGEESETEDKFQT
FT                   VTYQYNDGIKDYVDYLVKSRKATPVEPDVIDFEAEDLKIGISAEIAMQWTTAYSEAVHT
FT                   FANTISTTEGGTHEEGFRAALTSLVNRYAREKNILKDKDENLSGDDVREGLTAVVSVKL
FT                   TNPQFEGQTKTKLGNSEAKTFVQRVMTDKLGDWFDAHPNEAKNIIQKAIEASRARLAAK
FT                   KARENTRRKSIFESAGMPDKLKDCQSNNPEECELFIVEGDSAGGSAIQGRNPITQAILP
FT                   LRGKILNTERASLDRMMKSDTIESLITAVGGGYGEDFDLNKVRYHKVIIMADADVDGAH
FT                   IATLNLTLFFRYMRPMITAGYVYVAMPPLYRLKWTKGPHDFVYTDAERDRVLAEGKAAG
FT                   RQLPKGEGIQRYKGLGEMSYQELWETTMDPDHRILKQVQIEDAAAADETFSMLMGDEVE
FT                   PRRLFIQRNARNVSWIDA"
     atggcgggaa aaatgcagga aggaatctct gtggcagacc ttgatgcgga ttcgctgaac        60
     gaatcagctg aaaacacgca ggaagatcag attcaggatc agatccagaa cgaccagctc       120
     gaagatgcgc aacttgacga ttcgctgtct ccggaacact acgacgcgtc cgatctgagg       180
     gtgctggaag gccttgaggc ggtgcgtatc cgcccgggca tgtatatcgg ctccaccggc       240
     cctcgcggcc tgcaccatct ggtgtatgag atcgtcgaca actccgtcga cgaggcgctt       300
     gccggctacg cgtcgcacat cgaagtgacg attctgccgg acggcggcgt gcgtgtggtg       360
     gacgacggcc gaggcatccc ggtcgacgaa gtgccgggtg aaggcatctc cggtgtcgaa       420
     accgtgatga ccaagctgca cgctggcggc aagttcggtg gcggcggcta cgcggtttcc       480
     ggcggcctgc acggcgtggg catctccgtg gtgaacgcgc tgtccacccg cgtggacatc       540
     gaagtgcgcc gtcagggctt ccactggacc cagacctaca tcgaccagaa gccgaccgcg       600
     cgtctgctca agggcaagcc gatggaggaa ggcgagtcca ccggcacttc cgtgaccttc       660
     tgggccgatg gcaagatctt cgaaaccacc acctacgatt tcgagatcct gcgcaaccgc       720
     ttccagcaga tggcgttcct gaacaagggc ctgaagatct ccctgaccga cctgcgcgag       780
     cccgaccagg ccggcgacga ggtttccggc gaggaatccg aaaccgaaga caagttccag       840
     accgtcacct accagtacaa cgacggcatc aaggactacg tcgactacct ggtgaagtcc       900
     cgcaaggcca ccccggtcga accggacgtc atcgacttcg aggccgagga cctgaagatc       960
     ggcatctccg cggaaatcgc catgcagtgg accaccgcgt attccgaagc cgtgcacacc      1020
     ttcgccaaca ccatctccac caccgaaggc ggcacccatg aggaaggctt ccgcgccgcg      1080
     ctgacctcgc tggtcaaccg ttacgcccgc gagaagaaca tcctcaagga caaggacgag      1140
     aacctgtccg gcgacgacgt gcgcgaaggc ctgaccgccg tcgtgtccgt caagctcacc      1200
     aacccgcagt tcgaaggcca gaccaagacc aagctcggca actccgaagc gaagaccttc      1260
     gtgcagcgcg tcatgaccga caagctcggc gactggttcg acgcccaccc gaacgaggcc      1320
     aagaacatca tccagaaggc catcgaggcc tcccgtgcgc gtctggccgc caagaaggca      1380
     cgtgagaaca cccgccgcaa gtcgatcttc gaatcggccg gcatgccgga caagctcaag      1440
     gactgccagt ccaacaaccc cgaagaatgc gagctgttca tcgtggaggg tgattccgca      1500
     ggcggctccg ccatccaggg acgcaacccg atcacgcagg ccatcctgcc tctgcgaggc      1560
     aagatcctca acaccgagcg cgcaagcctg gaccgcatga tgaagtcgga caccatcgaa      1620
     tcgctgatca ccgccgtcgg cggcggctac ggcgaggact tcgacctcaa caaggtgcgc      1680
     taccacaagg tcatcatcat ggccgatgca gatgtggacg gcgcgcatat cgcaaccctg      1740
     aacctgacgc tgttcttccg ctacatgcgt ccgatgatca ccgccggcta cgtgtacgtg      1800
     gccatgccgc cgctgtaccg cctcaagtgg accaagggcc cgcacgactt cgtgtacacc      1860
     gacgccgaac gcgaccgcgt gctcgccgaa ggcaaggccg cgggccgcca gctgccgaag      1920
     ggcgaaggca tccagcgcta caagggtctg ggcgagatga gctaccagga actgtgggag      1980
     accaccatgg atcctgacca tcgcattctg aagcaggtgc agatcgaaga cgcggccgcg      2040
     gccgacgaga ccttctccat gctcatgggc gacgaagtcg aaccacgtcg tctgttcatc      2100
     cagcgcaacg cacgcaacgt cagctggatc gacgcgtaa                             2139
//

If you have problems or comments...

PBIL Back to PBIL home page