(data stored in ACNUC30630 zone)

EMBL: AP009256.INFB

AP009256.INFB        Location/Qualifiers
FT   CDS_pept        444544..447339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="BAD_0354"
FT                   /product="translation initiation factor IF-2"
FT                   /note="Orthologue of Rv2839c_BL1616"
FT                   /note="Protects formylmethionyl-tRNA from
FT                   spontaneoushydrolysis and promotes its binding to the 30S
FT                   ribosomalsubunits during initiation of protein synthesis.
FT                   Alsoinvolved in the hydrolysis of GTP during the formation
FT                   ofthe 70S ribosomal complex"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39135"
FT                   /db_xref="GOA:A1A0A2"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0A2"
FT                   /protein_id="BAF39135.1"
FT                   /translation="MPKARVYELAKELGVDSKTVLSKLEAMGEFVKSASSTVEPPVARK
FT                   LRNAFASSGQGNASDSKKPGHTAKKPAEPASHSMPKPAAPSAPKPAAPAAPKPRHAASK
FT                   SDAPKPGHRAPRPGESRQHGNRPNGNAPRPQGGDRRQSGRPTAVPGARPQHGNAPQGGN
FT                   NANGAKPHTPGPRPGNNPFSRKQGMHTPTPGDIPRPHPMNRPSVNNGEGRRGGRPGQGG
FT                   GQRGGFRGRPGQGGAKPGQWGQHRPGQGGGQRPAGGGNRFGGNGGGFQGGNSAPSNGPA
FT                   RGGRGRGGAAGAFGRQGGKSSKARKNRLAKRQEFQEMKAPVIGGVRIPTGNGQEVRLRQ
FT                   GASLADLAEKINVNPAALVTVLFHLGEMATATQSLDEATFQILGEEIGWNIKIVSAEEE
FT                   DKELLQQFDINLDEEELQEDGDLKPRPPVVTVMGHVDHGKTRLLDTIRRTNVIEGEAGG
FT                   ITQRIGAYQVTVNLEGEPRKITFLDTPGHEAFTAMRARGAELTDVAILVVAADDGVMPQ
FT                   TVEAINHAQAAHVPIVVAVNKIDKPGANPDKVRGQLTEYGLVPEEYGGNTMFVDISAKQ
FT                   GTNVDKLLEAVLLTADAELDLRANPDMDARGATVEARLDKGRGAVATVLVQSGTLHIGD
FT                   AIVAGTSYGRVRAMLDENGNHMQEAGPSTPVQVLGLTSVPTAGDLFLVASDDRTARQIA
FT                   EKRQATERAAQLAKRRKVVSLESLKEQFAKSEVDMLNIVIKGDSSGSVEALEDSLMKIE
FT                   VSDEVGIQVIHRGVGAITQNDVNLATVDKAVIIGFNVRPNRQVADLAEREGVEIKYYSI
FT                   IYKAIEDIEASLKGMLKPEYEEVVTSHSEIREIFRSSKFGNIAGVMVQDGEVKRGTKCR
FT                   ILRNGIATVNDLEISSLRRFKDDVTSVKEGYEAGINLGTFNDIEIGDIIETFEMQEIER
FT                   K"
     gtgccgaaag cacgcgtata tgaacttgcc aaggaacttg gcgttgacag caaaaccgtt        60
     ttaagcaaac ttgaggcgat gggcgaattc gtgaagtccg catcgtctac cgttgaacct       120
     cccgttgcac gcaagctgag gaacgcattc gcgtccagcg gacagggcaa cgcatctgat       180
     tccaagaagc cgggccatac ggccaagaag cctgccgaac cggcatctca ttccatgcca       240
     aagccggccg ctccgtcagc accgaagccg gctgcccccg cagcgccgaa gccgcgtcat       300
     gccgcttcca agtccgatgc cccgaagccg ggtcatcgcg cgccgcgtcc aggcgaatcc       360
     cgccagcatg gcaatcgtcc taacggcaac gccccgcgtc cgcagggtgg agaccgccgc       420
     cagtccggtc gcccgacggc cgttccggga gctcgccccc agcatggcaa cgccccgcag       480
     ggcggcaaca acgccaacgg cgcgaagccg cacaccccgg gaccgcgccc gggcaacaat       540
     ccgttcagcc gcaagcaggg catgcacacc ccgactccgg gtgatattcc gcgtccgcat       600
     ccgatgaacc gtccgagcgt caacaatggc gaaggacgtc gtggcggccg tccgggtcag       660
     ggcggcggcc agcgtggcgg cttccgtggt cgtccgggtc agggcggcgc gaagccgggc       720
     cagtggggcc agcatcgtcc gggtcagggc ggcggccagc gtcccgccgg cggcggcaat       780
     cgtttcggcg gcaatggcgg cggtttccag ggcggcaaca gcgctccgag caatggtccg       840
     gcacgtggtg gccgcggccg cggcggcgct gcaggcgcgt tcggacgtca gggaggcaag       900
     tcctcgaagg cgcgtaagaa ccgtctggcg aagcgtcagg aattccagga gatgaaggct       960
     ccggtcatcg gcggcgtgcg cattccgacc ggcaacgggc aggaagtccg tctgcgtcag      1020
     ggcgcgtccc tcgccgatct ggccgagaag atcaacgtca atccggcggc gctggtcacc      1080
     gtgctgttcc accttggtga aatggccacg gccacccagt ccctggatga ggccacgttc      1140
     cagatcctcg gcgaggaaat cggctggaac atcaagatcg tgtccgccga agaggaagac      1200
     aaggagctgc tgcagcagtt cgacatcaac ctggacgaag aggaactgca ggaggacggg      1260
     gatctgaagc cgcgtccgcc ggtcgtcacc gtcatgggcc atgtcgacca cggtaagacc      1320
     cgactgctcg acaccatccg ccgcaccaac gtcatcgaag gcgaagccgg cggcatcacc      1380
     cagcgcatcg gcgcatacca ggtgaccgtc aaccttgagg gcgagccgcg caagatcacg      1440
     ttcctcgata ccccgggcca cgaagccttc accgcaatgc gtgcccgtgg cgccgaactc      1500
     accgacgtcg cgatcctcgt ggtcgccgcc gacgacggcg tcatgccgca gaccgtggaa      1560
     gccatcaacc acgcccaggc cgcgcatgtg ccgatcgtgg tggccgtcaa caagatcgat      1620
     aagccgggcg ccaacccgga caaggtccgc ggccagctca ccgaatacgg tctggttccg      1680
     gaagaatacg gcggcaacac catgttcgtc gacatctccg cgaagcaggg caccaacgtc      1740
     gacaagctgc tcgaagcggt gctgctcacc gccgacgccg agctcgacct gcgcgccaac      1800
     ccggatatgg acgcccgtgg cgccaccgtc gaagcccgac ttgacaaggg ccgtggcgcc      1860
     gtggctaccg tgctggtgca gtccggtacc ctccacatcg gcgatgccat cgttgccggc      1920
     acctcctacg gtcgtgtccg cgccatgctc gacgagaacg gcaaccacat gcaggaagcc      1980
     ggtccgtcca ccccggtgca ggtgctgggt ctgacctccg tgccgaccgc aggcgacctg      2040
     ttcctggtgg cctccgacga ccgtaccgca cgtcagatcg ccgagaagcg tcaggccacc      2100
     gagcgtgcgg cccagctggc caagcgccgc aaggtcgttt ccctcgaaag cctcaaggag      2160
     cagttcgcca agtccgaggt ggatatgctc aacatcgtca tcaagggcga ttcctccggt      2220
     tccgtcgagg ctctggaaga ttccttgatg aagatcgagg tgtccgacga ggtcggcatc      2280
     caggtgatcc accgcggcgt cggcgccatc acccagaacg acgtcaacct ggccaccgtc      2340
     gacaaggccg tcatcatcgg cttcaacgtc cgtccgaacc gccaggtggc ggatctggcc      2400
     gaacgcgaag gtgtggagat caagtactac tcgatcatct acaaggccat cgaggacatc      2460
     gaagcatccc tcaagggcat gctcaagccg gaatacgaag aggtcgtcac ctcccactcc      2520
     gagatccgcg agatcttccg ctcctccaag ttcggcaaca tcgccggcgt catggttcag      2580
     gacggcgagg tcaagcgtgg tacgaagtgc cgtatcctgc gcaacggcat cgccaccgtc      2640
     aacgacctcg agatctcctc gctgcgtcgt ttcaaggacg acgtcacctc cgtcaaggaa      2700
     ggctacgagg ctggcatcaa cctcggcacc ttcaacgaca tcgagatcgg cgatatcatc      2760
     gagaccttcg aaatgcagga aatcgagcgt aagtag                                2796
//

If you have problems or comments...

PBIL Back to PBIL home page