(data stored in ACNUC30630 zone)

EMBL: AP009256.PE120

AP009256.PE120       Location/Qualifiers
FT   CDS_pept        168694..170199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0120"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted unusual protein kinase"
FT                   /note="Orthologue of BL0427"
FT                   /note="PFAM_ID: ABC1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38901"
FT                   /db_xref="GOA:A0ZZL8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL8"
FT                   /protein_id="BAF38901.1"
FT                   /translation="MRLMLEALGPTFVKVGQILSMRSEILPQSFCDELSKLRAGADPMP
FT                   YSTVLQVLEDEYGRPVDEIFDHIDPTPLGSASLAQVHRAKLLTGEDVAIKVQRPGVRET
FT                   MAQDVSIMRTIAGIATKTMRSAQVVDLSGVVEELWDTFESETDFLIETRNLAEFKRFCE
FT                   RYKYMDCPKPYPELCTEHVVVMDYVEGISVSHPDELLAAGYDLKEIGTKLVDNYATQVL
FT                   DEGFFHADPHPGNIMVRGGQIVLLDLGMTGRLNAKTRSVLKDMIFAVAEQDSPKLADGL
FT                   LRFAGAEADPEDYPALLADLDVIVKEFGTVDLAELDIAAMLTALTQMAQRHGIEVPSTV
FT                   TTVGRALVTLEGLLDEFIPDVNMIQIISDHIASSTSKKDFAKDETKSLALESHQALHSL
FT                   LAAANELKVASRMLTRGQLRVNMEMVGSQEPIHLLANMVNRLTMALIVVGLFIGSSIVY
FT                   YAGIKPVIFGIPIVGFLGYVIAFILSVWIVFDIYFKGRDSKKR"
     atgcgtctca tgctcgaagc gctcggcccc acgttcgtca aggtcggaca gatcctgtcc        60
     atgcgctccg aaatcctgcc gcaatcgttc tgcgacgaac tgtccaaact gcgcgccggc       120
     gccgacccca tgccatacag cacggtgctg caggtgcttg aggacgaata cggccggccc       180
     gtggacgaga tcttcgacca tatcgacccc accccgctcg gctcggccag ccttgcgcag       240
     gtgcatcgtg cgaaactgct caccggcgag gacgtggcca tcaaagtgca acgtccgggc       300
     gtgcgcgaaa ccatggcgca ggacgtgtcc atcatgcgca ccatcgcggg aatcgccacc       360
     aaaaccatgc gcagcgcgca ggtggtggac ctgtccggcg tggtcgagga actgtgggac       420
     accttcgaat cggaaaccga cttcctcatc gaaacgcgca atctggcgga attcaaacga       480
     ttctgcgaac gctacaaata catggactgc ccgaagccgt acccggaact atgcaccgaa       540
     cacgtggtgg tcatggacta cgtggaaggc atctccgtct cccatccgga cgagctgctt       600
     gcagccggct acgacctgaa ggaaatcggc accaaactcg tggacaacta cgccacgcag       660
     gtactcgacg aaggcttctt ccacgcggac ccgcaccccg gcaacatcat ggtgcgcggt       720
     gggcagatcg tgctgctcga cctgggcatg actggccggc tcaacgccaa aacccgttcc       780
     gtgctgaagg acatgatctt cgccgtggcc gagcaggatt cccccaagct tgccgacggt       840
     ctgctgcgtt tcgccggagc tgaggccgat ccggaggatt atccggcatt gctggccgat       900
     ctggacgtga tcgtcaagga attcggcaca gtggacctgg ccgaactgga catcgccgcc       960
     atgctgacgg ccctgacgca gatggcgcaa cgccacggca tcgaagtgcc gagcaccgtc      1020
     accacggtcg gccgcgcgct ggtcacgttg gagggattgc ttgacgaatt cattcccgac      1080
     gtgaacatga tccagatcat ctccgaccac atcgcgtcga gcacgtcgaa gaaggatttc      1140
     gccaaggacg agacgaaatc gctggctctc gaaagccatc aggcgctgca cagtctgctt      1200
     gccgccgcca acgagctgaa agtggcgtcc cgcatgctca cgcgcggcca gctgcgcgtc      1260
     aatatggaga tggtcggttc gcaggagccg atccacctgc tcgccaacat ggtgaacagg      1320
     cttacgatgg cgcttatcgt ggtcggcctg ttcatcggct cgtcgattgt gtattacgcg      1380
     ggcatcaagc cggtgatttt cggcattccg attgtcggtt tcctcggcta tgtgatcgcg      1440
     ttcatcctgt ccgtctggat tgtgttcgac atctacttca agggacgcga ttcgaagaag      1500
     cggtag                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page