(data stored in ACNUC30630 zone)

EMBL: AP009256.PE130

AP009256.PE130       Location/Qualifiers
FT   CDS_pept        181736..182506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0130"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0507"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38911"
FT                   /db_xref="GOA:A0ZZM8"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM8"
FT                   /protein_id="BAF38911.1"
FT                   /translation="MRDACGWEYCAAWLASMAVWLWLNRNVEWAGLRRLQRVLVRFGLR
FT                   SADDSGGADGDGTCDDESDGHGRTVRNDGENRDASPRMPTIGAAACVAALRASVRSGAT
FT                   LVQAFEELQGAPFAVPELTRFRIDMAVRSRCSLQEQHKHVDQLGAELHAACTLSLQLGC
FT                   EMSRCLEAVAASLKRRRLLDDLRANAFAMPQATVKLLMALPLLTVMLGECMGAHPLRFL
FT                   VEDVKGWMCLGFAGCCYAVGWYWIRRLMRQEHVR"
     atgcgtgatg cgtgtggttg ggaatattgc gccgcatggc tggcgtcgat ggccgtctgg        60
     ctgtggctga atcggaacgt ggaatgggcg ggattgcggc gattacagcg tgtgctggtt       120
     cgcttcgggc ttcgttcggc tgacgatagc ggcggggccg atggagatgg aacttgtgat       180
     gatgaatccg acgggcatgg cagaacagtc cggaacgatg gggaaaaccg ggatgcatcg       240
     ccacggatgc cgaccatcgg cgctgccgca tgcgtggccg cgctgcgggc gtccgtacgc       300
     agcggagcca ccttggtcca agcgttcgag gaattacagg gcgctccttt cgcagtgcct       360
     gaactgaccc gtttccgtat tgacatggcc gtacgaagcc gctgctcgct tcaggaacaa       420
     cacaagcatg tggatcagct tggtgcggaa cttcatgcgg cctgcacgtt gagtctgcag       480
     ttgggctgcg agatgagccg atgcctggag gccgtcgcgg cgtcgttgaa gcggcgacgg       540
     ctgctcgacg acttgcgtgc caacgctttt gccatgccgc aggccacggt gaagctgctg       600
     atggcattgc cgttgctgac ggtgatgcta ggggaatgca tgggagccca tcccttgcga       660
     ttccttgtgg aagacgtgaa aggatggatg tgcctcggct tcgccggctg ctgttatgcc       720
     gtcggctggt attggattcg caggctgatg cggcaggagc atgtgcgatg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page