(data stored in ACNUC30630 zone)

EMBL: AP009256.PE144

AP009256.PE144       Location/Qualifiers
FT   CDS_pept        complement(196123..197646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0144"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0490"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38925"
FT                   /db_xref="GOA:A0ZZP2"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP2"
FT                   /protein_id="BAF38925.1"
FT                   /translation="MSLRFNSDGTFRVLQMADIQDGPDVREDTIRLIEGAIRKAHPDLI
FT                   VLTGDQIRGYDPAYIDTFLRRRGEQPGTHVRAVTEIEAKIRGIKRHPIAKTLTKSQPSD
FT                   ERWMIDGIGTDSPKLVKSAGRNGSASKLESWAEAINRATAASLLDETRQKVRDTFAAFL
FT                   GPALESRIPFAATYGNHDFQCGILADEQDDLYREFAGCMNPVAGSSPLALEPGTFALPI
FT                   EASDGSGRITMSVMMVNSGDYADTADAGDGNGRQSVTEYAKYAANSRGWDLADSDGYGT
FT                   PSPEAVEWLKRVQRELGRRNGDGQAVPAIAFQHIPPQEFYDCLREVPAYTPNAVEGARE
FT                   FAGHCYVLDRDVCRPGSRLGEAIGCADVNVGEVDALREAGGYFALFCGHDHKNSFVGHV
FT                   HDIDLGYAPTCGFECYGPKSRFRGIRLFEFREDNPMAYVTRMLTWGDLVGRYSSNELRV
FT                   FFEDHCVTDLIGVRNELRRPQVSATLLGAGAVTCGAIGYAVRGLLRKSQ"
     atgagcttgc gattcaacag cgacggtacg ttccgggtgc tgcaaatggc tgatattcag        60
     gatggtccgg acgtgcgcga agacacgatt cggctgatcg aaggcgctat caggaaggca       120
     catcccgacc tcatcgtgct caccggcgat cagatccgcg gctacgatcc ggcatatatc       180
     gatacgtttc tacgtcgccg tggcgaacag cccggtacgc acgtgcgcgc ggtcaccgaa       240
     atcgaagcga aaatccgcgg catcaaacgt catccgatcg ccaaaacact gaccaaatcg       300
     cagccctccg acgaacggtg gatgatcgac ggcatcggca ccgattcgcc gaaactggtg       360
     aaaagcgcag gtcgcaacgg ttctgccagc aagctggaat cgtgggcgga agccatcaat       420
     cgcgccaccg cggcgtcgct gctcgacgag acacggcaga aagtgcgcga cacgttcgcc       480
     gcgtttttgg ggccggcgtt ggaatcgcgt atccccttcg ctgcgacgta cggcaaccat       540
     gatttccaat gcggcatcct cgccgacgaa caggacgatc tttaccgcga gtttgccggc       600
     tgtatgaatc ccgtcgccgg ctcgtcgccg ttggcgctcg aaccgggcac gttcgcgttg       660
     ccgatcgaag cgtccgacgg ttcggggcgc atcacaatga gcgtgatgat ggtcaattcg       720
     ggcgattacg ccgacacggc agacgcgggt gacggcaacg gacggcagtc ggtcaccgaa       780
     tacgcgaaat acgcggcgaa ttcgcgcggc tgggatttgg ccgactccga cggctacggc       840
     accccctcgc cggaagccgt cgaatggctg aagcgcgtgc aacgcgagtt gggcaggcgc       900
     aatggcgacg ggcaggcggt gccggcgatc gccttccagc acattccgcc gcaggaattc       960
     tacgattgcc tgcgcgaagt gcccgcctac acgccgaacg ccgtggaggg cgcgcgcgaa      1020
     ttcgcaggac attgctatgt gctcgaccgc gatgtgtgcc gacccggttc gcggctgggc      1080
     gaggcgattg gctgcgccga cgtgaacgtg ggcgaagtgg acgcgctgcg tgaggcgggc      1140
     ggctatttcg cgctgttctg cgggcatgac cacaagaatt cgttcgtcgg gcatgtgcac      1200
     gacatcgatt tggggtacgc gccgacctgt ggttttgaat gctacggccc gaaatcgcgg      1260
     ttccgcggca tccggctgtt tgaattccgc gaagacaatc cgatggcgta cgtgacgcgc      1320
     atgctgacgt ggggcgatct ggtcggccgt tattccagca acgaattacg cgtgttcttc      1380
     gaggaccatt gcgtgacgga cctgatcggc gtgcgcaacg agctgcgcag gccgcaggtc      1440
     agcgccacgc tgctaggggc gggcgcggtg acgtgcggcg cgatcggata cgcggttcgg      1500
     gggctgttgc gcaaatcgca gtaa                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page