(data stored in ACNUC30630 zone)

EMBL: AP009256.PE17

AP009256.PE17        Location/Qualifiers
FT   CDS_pept        complement(20714..21538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0017"
FT                   /product="conserved phage-associated protein"
FT                   /note="Orthologue of PPA1609"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38798"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB5"
FT                   /protein_id="BAF38798.1"
FT                   /translation="MRNTWIRRISAIRKDGVESAINLTCGLNCIIGASNTGKTRIAKTV
FT                   EFACGGKELPFTDKTAYEIAQVTFVTNGGEVSLSRSIHVQNTIHVKSSNPMIVPGSYSV
FT                   SSRAGKSINTVLLALLGVESTRRIATNETYHTVAFTWNAIRHLMIVPEDQIGRARPSIL
FT                   FPKSTSLATLTQSLSSLLVLVQDEKIDNSIQTESASERHARRKAVEQFIHQQLDDIEPR
FT                   IRHLEEMRHIATNEGKTIHTYLRPSQKSITRRTAKTNSPQSRCPYHLTYLSA"
     atgagaaaca catggatacg tcgaatttcg gcaatcagaa aggacggagt ggaatccgcc        60
     attaatctca catgcgggct gaactgcatt atcggcgctt cgaacaccgg gaaaaccaga       120
     atcgcaaaaa ccgtggaatt tgcctgcgga gggaaagagc tcccctttac cgataaaact       180
     gcctatgaaa ttgcacaggt cacgttcgtg accaacggcg gtgaggtttc gcttagtcgt       240
     tcgattcacg ttcagaacac tatccatgta aaatccagca acccaatgat cgtccccggt       300
     tcctactccg tttcatcacg tgccggtaaa tcaatcaata cggttcttct tgccttacta       360
     ggcgttgaat caacccgtag aatagcgaca aacgaaacct accatacagt tgctttcaca       420
     tggaatgcca tcagacatct catgattgtc cccgaggacc aaataggacg tgcacgcccc       480
     tccattcttt tccccaaaag tacctctcta gcaactctca cacaaagtct gtcctcgttg       540
     ctcgtgctag ttcaagatga aaaaatcgac aactccatac agacagagag tgccagcgaa       600
     cgtcacgccc gcagaaaagc cgtggaacag ttcatccatc agcagttgga tgatatagag       660
     cctcgcatca gacaccttga ggagatgcgc catatcgcaa caaatgaggg gaagaccatt       720
     cacacctatt taagaccttc acaaaaaagc attacacgta gaacagcaaa gacaaactct       780
     cctcaatcga gatgcccata ccatctcaca tatctctcag cttaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page