(data stored in ACNUC30630 zone)

EMBL: AP009256.PE182

AP009256.PE182       Location/Qualifiers
FT   CDS_pept        247942..249084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0182"
FT                   /product="hypothetical protein"
FT                   /note="COG family: dihydroorotate dehydrogenase"
FT                   /note="Orthologue of BL1265"
FT                   /note="PFAM_ID:DHOdehase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38963"
FT                   /db_xref="GOA:A0ZZT0"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT0"
FT                   /protein_id="BAF38963.1"
FT                   /translation="MSQGFAPFYDVNRTYEDNYLQGPFGAFAEVMKGDSAAGASAQSAQ
FT                   TTQSQSSDQAEEFLGFRVNLPFGIPAGPLLNERFTTAAFRMGFDLAVYKTVRSRAWGCN
FT                   AFPNVLAVHPKNADGSLVPGSAELDEGVLADTRYELPISISNSFGVPSRDPDEWQPDMK
FT                   KAIAAAGDGQLLVPSFQGSRVDGMDRKAYIADHVTTAHLVTETGAGLMEMNTSCPNEGH
FT                   NRLLCHDPHLVGEITEAVKNEIGDRPLIVKLAYIPNDTDLETMVRETVGHGTVQGFSTI
FT                   NTISARLVDANGNQALPGAGRDRSGVCGNAIRGAGLDMVGRLAAIREKLGFDFAIVGVG
FT                   GVIRPDDYKAYREAGANAVMSATGAMWDANLAREIKETLR"
     atgagccagg gtttcgcgcc gttttacgac gtcaatcgca cgtatgaaga caactatctg        60
     caggggccct tcggtgcgtt cgccgaagtg atgaagggcg attccgctgc cggcgcctcc       120
     gcgcagtctg cacagaccac ccagtcgcag tcgtccgacc aggccgagga attcctcggc       180
     ttccgcgtga acctgccgtt tggcattccc gctggtccgc tgctgaacga gcggttcacc       240
     accgccgcct tccgcatggg tttcgatttg gcggtgtaca agacggtccg ctcccgcgcg       300
     tggggttgca acgccttccc gaacgtgctc gccgtgcatc cgaagaacgc agacgggtct       360
     ctggttcccg gcagcgccga actggatgaa ggcgtgcttg ccgacacccg atatgagctt       420
     ccgatttcga tctccaacag tttcggcgtg ccgtcgcgtg accccgacga atggcagccg       480
     gacatgaaga aggcgatcgc cgccgccggc gacgggcagc tgctcgtgcc cagcttccaa       540
     ggttcccgcg tggacggcat ggaccgcaag gcgtacatcg ccgaccatgt caccaccgcg       600
     catctggtta cggaaaccgg agccggactg atggaaatga acaccagctg ccccaacgaa       660
     ggtcacaatc gcctgctgtg ccacgacccg catctggtgg gggaaatcac ggaagccgtg       720
     aaaaacgaaa tcggcgatcg cccgctcatc gtgaaactcg cctacattcc caacgacacc       780
     gacctggaaa ccatggtcag ggaaaccgtc ggacatggca ccgtgcaagg cttctccacc       840
     atcaacacga tttccgcgcg cctagtggac gcgaacggca accaggcgct gccgggagcc       900
     ggacgtgacc gttccggcgt gtgcggcaac gccatccgcg gcgccggtct cgacatggtc       960
     ggcaggctcg ccgccatccg tgaaaaactc ggcttcgact tcgccatcgt gggcgtgggc      1020
     ggcgtgatcc gtcctgacga ctacaaggcg taccgtgagg ctggcgcgaa cgccgtgatg      1080
     agcgccaccg gagccatgtg ggacgcgaat ctcgcgcgcg aaattaagga gacactgcgc      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page