(data stored in ACNUC30630 zone)

EMBL: AP009256.PE188

AP009256.PE188       Location/Qualifiers
FT   CDS_pept        255537..256451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0188"
FT                   /product="possible permease protein of ABC transporter
FT                   system"
FT                   /note="COG family: ABC-type spermidine_putrescinetransport
FT                   system_ permease component I"
FT                   /note="Orthologue of BL0343"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38969"
FT                   /db_xref="GOA:A0ZZT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT6"
FT                   /protein_id="BAF38969.1"
FT                   /translation="MTAVLTSGAHAKRAGSSAISFAAHRRELGTIAVSIPFFAYTACFL
FT                   LAPTVIVIVGAFQSADGSFTVANFNKLFEANTIAAFGTSILVSVASAVIGAIVGALASY
FT                   ALVIGSKPNGLLRRMISAISSVLAQFGGVMLAFAFIATIGINGVGTMLIKQLTGYVVNP
FT                   NWLSSLPGLITIYCYFQIPLMIIIFLPAVDSIRPQWREATESLGGNTFQYWTRVAGPIL
FT                   APRFISAFLLLFASAFSAYATAAALFSQRSILVPLMIQGAMRNEMDPNQQGFAQVLAFA
FT                   MIVVVAVVMMISHAVEKRAGRWQ"
     atgaccgcag tgcttacctc aggagctcac gccaagcgcg cgggctcctc cgccatctcg        60
     tttgccgcgc ataggcgtga actcggcacc atcgccgtgt ccatcccgtt cttcgcctac       120
     accgcgtgct tcctgctcgc cccgacggtc atcgtcatcg tgggcgcctt ccaatccgcc       180
     gacggcagct tcaccgtggc gaacttcaac aaacttttcg aagcgaacac catcgccgca       240
     ttcggcacat cgatactcgt atcggtcgca tccgcggtca tcggcgccat cgtgggcgcg       300
     ctcgccagct acgccctcgt catcggctcc aagccgaacg gcctgctgcg ccgcatgatt       360
     tcggccatct cgtcggtact cgcccaattc ggcggcgtga tgctggcgtt cgcgttcatc       420
     gccaccatcg gcatcaacgg cgtgggcacc atgctcatca aacagctgac cggctacgtg       480
     gtgaatccga actggctcag ctcgctgccg ggcctgatca ccatctactg ctacttccag       540
     attccgctga tgatcatcat cttcctgccc gcggtcgatt ccatccgccc gcagtggcgc       600
     gaagccacgg aaagcctcgg cggcaacacc ttccaatact ggacgcgcgt ggccggcccg       660
     attctggcgc cgcgattcat ctccgcgttc ctgctgctgt tcgcgtccgc gttctccgca       720
     tacgccacgg ccgccgcgct gttctcccag cgttcgatcc tcgtgccgct gatgatccaa       780
     ggcgcgatgc gcaacgaaat ggacccgaac cagcaaggct tcgcgcaggt gctcgccttc       840
     gccatgatcg tcgtcgtggc ggtggtcatg atgatcagcc acgccgtgga aaagagggcc       900
     ggacgatggc agtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page