(data stored in ACNUC30630 zone)

EMBL: AP009256.PE216

AP009256.PE216       Location/Qualifiers
FT   CDS_pept        complement(288010..289137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0216"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of MAP4318c"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38997"
FT                   /db_xref="GOA:A0ZZW4"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW4"
FT                   /protein_id="BAF38997.1"
FT                   /translation="MRLPQQIMSLAKAVRKPYLAGSIICICFFLLELTAWPNMSPWSWL
FT                   YLAPYCIALLLLAWFPVPASMAILVTHIACAIIPAICDGPSTLYGTWLACGIIAFEIKR
FT                   FEFAIMGPLLCALALPLGYWTGGIDYNPSIPVLACSYIGAFCVGFAVRWKAQTAQRKMD
FT                   LAIAQEQVRRQQKRLKEIHILHDSIAGAMTYAILLCRKKESSESSDTLPQIEQVLMQAL
FT                   HELRTQIISPMTDELKTDKEEDADELFQQHIEAQCKRLRILGFTGTPIIRGNLNAMDKS
FT                   LLPSLQTVCTEILNNIAKHGKPGAFAFILSVGPDAVRIFASNLYNAAINSAPENHYGTA
FT                   LIQDFAQQHNGTMTINSENEEWSLSLAIPLTHQTH"
     atgaggctgc cccaacaaat aatgtcattg gcaaaggccg tgcgcaagcc ctacttagcg        60
     ggatccatta tctgcatctg ctttttcctg ctcgagctga ccgcttggcc aaatatgtca       120
     ccttggtcat ggctatattt ggctccgtac tgcatcgccc tgctgctact ggcctggttc       180
     cccgtaccgg caagcatggc gattcttgta acacacatag catgcgcgat aatcccggca       240
     atatgcgatg gcccttcgac gttatatggc acatggcttg catgcgggat aatcgcattt       300
     gaaatcaaac gatttgaatt tgccatcatg ggaccgctgc tttgcgcact agcacttcct       360
     ttgggctatt ggacaggcgg catcgactac aatccaagca tccccgtgct tgcatgctcc       420
     tacattggag cattctgcgt tggttttgcc gtgagatgga aagcgcaaac agcacaacga       480
     aaaatggact tggcgattgc acaagaacaa gttcgacgcc agcagaaaag actcaaagaa       540
     attcacatac tgcacgattc catcgcagga gctatgacat atgcgattct gctgtgccgc       600
     aaaaaagagt cctcagagag cagcgacact ttgccacaga ttgaacaggt cctcatgcag       660
     gcattacatg agcttcgcac tcaaatcatc agcccgatga ccgatgagct taaaacagac       720
     aaagaggaag acgcggacga gctctttcaa caacatatag aagctcaatg caaaagactg       780
     agaatactgg gttttaccgg gacaccaata atccgcggga atctaaacgc aatggacaag       840
     tcactactac catcgttgca aacggtttgt accgaaattc tcaataacat tgccaaacac       900
     gggaaacccg gggcttttgc ttttatcctc tctgtaggac cagatgcggt ccgcatcttc       960
     gcatcaaatc tatataacgc cgcaataaat agtgctccag aaaatcacta cgggacagcc      1020
     ctcatacaag attttgcgca acaacataat gggacaatga ccataaattc agaaaatgaa      1080
     gaatggtcat tgtccctagc gattccgcta actcatcaaa cacattaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page