(data stored in ACNUC30630 zone)

EMBL: AP009256.PE217

AP009256.PE217       Location/Qualifiers
FT   CDS_pept        complement(289140..289769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0217"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain and a HTH DNA-binding domain"
FT                   /note="Orthologue of CP000255.1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38998"
FT                   /db_xref="GOA:A0ZZW5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW5"
FT                   /protein_id="BAF38998.1"
FT                   /translation="MRTIVNDPTLGIVDNDPLVASAIQSLLVETCAPIRILWTVTSAEQ
FT                   ALEAMRDSAQRPQAVLTDIAMPGMNGSELAHHIKEQHPDIAVIGISAFLDDENEKRYGA
FT                   QWSDAFYAIIPKEIPTIQLVRIIGKATGNDEVASWAGKSINSMRLSGKELQIIAGYARG
FT                   FTTSTIAHQLNISEASVKTYARRAFEKLHAHSRAEAVAMCVRNGWI"
     atgcgcacga ttgtcaatga tccgactttg gggattgtgg ataatgatcc actggtcgca        60
     agcgcaattc aaagcttgtt ggtcgagaca tgcgcaccaa tacggattct gtggactgtc       120
     acctctgcag aacaagcact tgaggccatg agggactctg cacaaaggcc acaagccgtg       180
     cttaccgata tcgcaatgcc tgggatgaac ggctcggaat tagcgcatca tatcaaggaa       240
     caacatccag atattgccgt cattggtatc agcgcctttt tggatgacga aaacgaaaaa       300
     agatacggag cacaatggtc cgatgcgttt tatgcgatta ttccaaaaga aattcccacg       360
     attcaactgg ttcgaatcat cggaaaagcc actggaaatg acgaggttgc gtcgtgggcg       420
     gggaagagca taaactccat gcggctttcc ggcaaggaat tacagatcat tgccggctat       480
     gcgagaggat tcaccacttc cactattgcg caccaactga atatcagcga agcatcggta       540
     aagacatatg cacgacgagc tttcgagaag ctccatgctc atagtcgtgc cgaagctgtt       600
     gcgatgtgcg taagaaacgg ttggatataa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page