(data stored in ACNUC30630 zone)

EMBL: AP009256.PE22

AP009256.PE22        Location/Qualifiers
FT   CDS_pept        27518..28351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0022"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0606"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38803"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC0"
FT                   /protein_id="BAF38803.1"
FT                   /translation="MFRRPAATPEQECHKAPAALGTQVAVYEDSIGQLILQWLRKPTYW
FT                   SEGSSGTQALWHAYTPEPVTPSELALSRQACGVACDAQPVIKGTLPNRDIAHMAATSLG
FT                   YLTWGVTNDPMDYGLGDLGGWALDLLQIWGSYLANTPKEDLASWLHAHLGEQDARMGFS
FT                   YSDVLADCDAWLLARSMQSNSSERSLSTAMRDMFAQSETNRIKRFYQSRFKGSADNLVI
FT                   AFRKLVDGIDLGIFDNVSGSKKALLIASHADRLPSQAEAGILALSYAESLENPNR"
     gtgttccgca ggccggcggc gacacccgag caggagtgtc acaaagcccc tgccgctctg        60
     ggtacccagg tggcggttta tgaggacagc atcggtcaac tcatcctgca atggctccgc       120
     aaacctacgt actggtcgga aggtagttcc ggcacgcagg cactatggca tgcatacaca       180
     ccggagccgg ttactcccag cgaattggcc ttgtcgcgtc aggcatgcgg tgtcgcatgt       240
     gatgcacagc ctgtcatcaa aggcacgctg cccaatcggg acatcgccca tatggctgcc       300
     acatccttgg gatacttgac atggggcgtt acgaacgatc caatggacta tggtctcggt       360
     gatctgggcg gatgggctct ggatttgctg cagatttggg gaagctacct ggcgaatacc       420
     ccgaaagagg acctggcgtc atggctgcac gctcatctcg gcgagcaaga cgctcgtatg       480
     ggattcagtt acagcgatgt tctcgcggac tgtgatgcat ggttgctggc gcggtccatg       540
     cagagcaatt cttccgaaag gtctttgtcc accgctatgc gggacatgtt cgcgcaaagc       600
     gagacgaatc gaattaaacg gttctatcag tcccggttca agggaagtgc ggacaacctg       660
     gtcatcgcat ttcgaaagct tgttgatgga atcgatcttg gaatattcga taacgtatcc       720
     ggaagtaaaa aagcactgct cattgcgtca catgcagacc gactcccgag tcaagcggag       780
     gctggtatat tggcattatc ctatgctgaa tctcttgaaa atccgaaccg ttaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page