(data stored in ACNUC30630 zone)

EMBL: AP009256.PE225

AP009256.PE225       Location/Qualifiers
FT   CDS_pept        complement(296154..296768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0225"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted metal-binding_ possiblynucleic
FT                   acid-binding protein"
FT                   /note="Orthologue of BL0293"
FT                   /note="PFAM_ID: DUF177"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39006"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX3"
FT                   /protein_id="BAF39006.1"
FT                   /translation="MARTEDSPWAVSVAQVASRPGQSKEIDATFPAPSGIGDEIVGVDE
FT                   GADVSVVGSFDSIVDGLILNARISAPVHAECTRCLKPIQRDWTVNVTSFFPYEDKSAAG
FT                   KGGKAGKNGKEEEVDIIAGEDEAEDTYPLLDGGAWADLEALLRDTLVEELPLQPLCKPD
FT                   CKGLCSQCGIDLNENPDHQHDMTDIRFAALEGLKAKLEGKE"
     atggcacgta ctgaagattc cccatgggcc gtttccgtgg cgcaggtggc ctcgcgtccg        60
     gggcaaagca aggagatcga cgccactttc cccgcgccga gcggcatcgg cgatgagatc       120
     gtcggcgtgg acgaaggcgc ggatgtgagc gtggtcggct cgttcgattc gatcgtcgac       180
     ggtctgattc tgaacgcgcg tatcagcgct cccgtgcatg ccgaatgcac gcgctgcctg       240
     aagccgatcc agcgcgattg gacggtgaac gtcacctcct tcttcccgta tgaggacaag       300
     tccgccgccg gcaagggcgg aaaggccggc aagaacggca aggaagagga agtggacatc       360
     atcgccggcg aggacgaggc ggaagacacg tacccgctgc tcgacggcgg cgcatgggcc       420
     gacctcgagg cgctgctgcg cgacacgctg gtcgaggaac tgccgctgca gccgttgtgc       480
     aagccggatt gcaagggcct gtgctcgcag tgcggcatcg acctcaacga gaaccccgac       540
     catcagcatg acatgaccga cattcgtttc gccgcgctgg aagggctgaa agccaagctg       600
     gaaggcaagg aataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page