(data stored in ACNUC30630 zone)

EMBL: AP009256.PE226

AP009256.PE226       Location/Qualifiers
FT   CDS_pept        complement(296824..297654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0226"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0292"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39007"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX4"
FT                   /protein_id="BAF39007.1"
FT                   /translation="MMSEETNDFKPLADADDATSQQPVTPAADYPATGAVAGTAATNNS
FT                   ATGNAADRATDEPAKPAKSSKPSISMSDLPDLRATFDPDAPLDDSSDRSRDEFTTVYDI
FT                   IDSIEEELDEAKPILFAPSSVRVDRESFTGKLDKLKKMLPVQLERASALMRESERRLES
FT                   AQTQANVIIASAQSRAADTVREANEQAQFLAGQENVTELARQKARGILDQAQAKADKLT
FT                   QNADKYCITMMESLQQQVDKIGTGVQAGLNVLYDRQREAGAHLDHLDADDYPEN"
     atgatgagtg aagagaccaa cgatttcaag ccgcttgctg acgccgatga cgccacgtcg        60
     cagcagccgg tcacgccggc ggccgattat ccggccaccg gcgctgttgc cggtaccgca       120
     gcgaccaaca actccgcaac cggcaatgcc gccgaccgtg ctacggatga gccggcaaag       180
     cccgcgaaat cgtcgaaacc gtcgatttcc atgtcggacc tgcccgacct tcgtgccacg       240
     ttcgatcccg atgcgccact cgacgacagt tcggatcgca gccgcgacga attcaccacc       300
     gtctacgaca tcatcgacag catcgaagag gaattggacg aggccaagcc gattctgttc       360
     gcgccgagct cggtgcgcgt ggaccgcgaa tcgttcaccg gcaagctcga caaactcaag       420
     aagatgctgc cagtgcagct ggaacgcgcc tccgcgctga tgcgcgaatc ggaacgccgt       480
     ctggaaagcg cgcaaacgca agccaacgtg atcatcgcat ccgcgcagtc gcgtgccgcc       540
     gacaccgtac gcgaagccaa cgagcaggcg cagttccttg ccgggcagga gaacgtgacg       600
     gaactcgcca ggcagaaggc gcgcggcatt ctcgaccagg cgcaagccaa ggccgacaag       660
     ctcacgcaga acgccgacaa atactgcatc accatgatgg aatcgttgca acagcaggtc       720
     gacaagatcg gcaccggcgt gcaggcgggc ctgaacgtgc tgtacgatcg ccaacgcgaa       780
     gccggcgcgc atctggacca tctcgatgcg gacgattatc cggaaaactg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page