(data stored in ACNUC30630 zone)

EMBL: AP009256.PE239

AP009256.PE239       Location/Qualifiers
FT   CDS_pept        312697..315510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0239"
FT                   /product="ribonuclease G"
FT                   /note="Orthologue of SCO2599_BL1281"
FT                   /note="SCC88.10c_ hypothetical protein;N-terminal region
FT                   similar to TR:P71905"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39020"
FT                   /db_xref="GOA:A0ZZY7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY7"
FT                   /protein_id="BAF39020.1"
FT                   /translation="MPRSVVPTTNEGLDQVEAVVSSDNSTNNAASSAGSVSADPAPRRR
FT                   RGGRRVVRGVGAAGASLELKVEEHAKAPLFEEPKLEPVQPARDSADFNDADDAEPSRPR
FT                   RRRVTRYDDDDEMRDERPRRRRRSSVDVQDEDDRPSRRRRRISDEPRDDRDDRDDYGNR
FT                   GNRDESSEDRALDAVSALPEGHETRHNPRPMTSLLFQEPILPAAPAGRGSSDDDDADDT
FT                   GRRGSDDARDSRDDRDDDRPTRRRRRRSHDTADTDRTDASNDGRGRDDGNDRNNDAEDD
FT                   DHGDSRRSRRSRRLNAQERRAAAEVEQIEEDLVLDGITYAPIDDESRNGNDDDDEQPTR
FT                   TRRRRRGRGNHEEADEQQTSERESRRRHEDDDEEEGTVTRRRRRRRGGSKAEESDETMS
FT                   RRSRKQQYIDEITDVEGSTRLEAKKQRRRDNRRERSRQNQLMEQDFLARREHVERLMVV
FT                   RERERHTQISVIEDNVLVEHYVSDIQEVATVGNIYLGRVQNVLPSMEAAFVDIGQARNG
FT                   VLYAGEVNWDSARLEGQPRRIELAFKSGDPVLVQVTKDPIGHKGARLTSQVTLAGRFLV
FT                   LVPSGGMTGVSRKLSERERARLKNIVSKIAPKDMGVIIRTAAEGASEEAITKDLENLVR
FT                   QWERITAKRDEFLHGKRPKLLQGEPDVAIRVVRDIFNDDFSKMIVEGDRVYERIEEYLD
FT                   TMAPDLKDKLEKWDPAEHDGKDVFDKWQIDSQLRKGMERQVYLPSGGSIVIDRTEAMTT
FT                   IDVNTGRFIGRGKSLEETVTRCNLEAAEEIARQLRLRDIGGMVMIDFVDMVMPANRDLV
FT                   LRRLVECLARDRTKHQVAEVTSLGLVQMTRKRIGQGLVEAFSEECPTCKGRGFILHDEP
FT                   TVSADYDDPYALKGGDPFVKTNKHGHGTDVQVPKGSSPDVKAKLAQIAAAAVAANNADL
FT                   GEEEQEE"
     ttgccgagga gcgttgtgcc tactaccaat gagggcctcg atcaggtcga ggctgttgtg        60
     tcatccgata attcaaccaa taatgcggca agcagtgcgg gttctgtgtc tgccgatccg       120
     gctccgcgcc gccgtcgtgg aggtcgccgc gtggtgcgtg gcgtaggtgc cgcgggcgcg       180
     tctttggagc tgaaggtcga ggagcatgcc aaagccccct tgtttgagga accgaagctt       240
     gagcctgtcc agcctgcgcg tgattccgcc gatttcaatg atgccgatga cgccgagccg       300
     tcgcgtccgc gtcgtcgtcg cgtgacccgt tacgatgacg acgatgagat gcgtgacgaa       360
     cgtccgcgcc gtcgccgtcg ttcctctgtg gacgtgcagg acgaggatga tcgcccgtcg       420
     cgtcgccgtc gccgtatcag cgacgagccg cgtgatgacc gtgacgatcg tgacgattac       480
     ggcaatcgtg gcaatcgtga cgaatcatcc gaagaccgtg cgctcgacgc cgtcagcgcg       540
     ctgccggaag gccatgagac gcgtcataat ccgcgtccga tgacgtcgct gctgttccag       600
     gagccgattc tgccggccgc ccccgcgggc cgcggatcgt ccgacgatga cgatgctgac       660
     gatacgggcc gcagaggttc ggacgatgcc cgtgacagcc gtgatgaccg cgacgatgac       720
     cgtccgactc gtcgccgccg ccgtcgcagc cacgacacgg ccgacacgga ccgcacggac       780
     gcttcgaatg acggtcgcgg ccgtgatgat ggcaatgacc gcaacaacga cgccgaagac       840
     gatgatcatg gcgattcccg tcgttcccgt cgttcccgtc gtctgaacgc gcaggaacgt       900
     cgtgccgctg ccgaagtgga gcagatcgag gaggacctgg tcctcgatgg catcacgtat       960
     gcgccgatcg atgacgagtc ccgcaatgga aacgatgatg atgacgagca gccgacgcgc      1020
     acccgtcgcc gccgtcgcgg acgcggcaac catgaggaag ccgacgagca gcagacctcc      1080
     gaacgcgaat cccgtcgccg tcatgaggat gacgatgagg aagagggcac ggtgacccgt      1140
     cgccgtcgcc gccgccgtgg agggtcgaag gccgaggaat cggacgagac gatgtcccgt      1200
     cgctcccgca agcagcagta catcgacgaa atcaccgacg tcgaaggatc cacccgtctg      1260
     gaagccaaga agcagcgccg ccgcgacaac cgtcgtgaac gcagccgtca gaaccagctc      1320
     atggagcagg acttcctggc ccgtcgcgaa cacgtcgagc gtctgatggt ggtgcgcgaa      1380
     cgtgagcgcc acacccagat ctccgtgatc gaagacaatg tgctcgtcga gcattacgtg      1440
     tccgacatcc aggaagtggc caccgtcggc aacatctatc ttggccgcgt gcagaacgtg      1500
     ctgccgagca tggaggccgc gttcgtggac atcggacagg cccgcaacgg cgtgctgtac      1560
     gccggcgagg tgaactggga ttccgcacgt ctggaaggcc agccgcgtcg tatcgaactg      1620
     gcgttcaagt cgggcgatcc ggtgctggtg caggtaacca aggatccgat cggccacaag      1680
     ggcgcaaggc ttacctcgca ggtcaccttg gccggccgtt tcctcgtgct ggtgccgtcc      1740
     ggcggcatga ccggcgtgag ccgcaagctg agcgagcgtg agcgcgcccg cctgaagaac      1800
     atcgtgtcga agatcgcgcc gaaggatatg ggcgtgatca tccgaaccgc ggccgaaggc      1860
     gcttccgaag aggccatcac caaggatctc gagaacctgg tgcgccagtg ggaacgcatc      1920
     accgccaagc gcgacgagtt cctgcacggc aagcgtccga agctgctgca aggcgagccg      1980
     gacgtggcca tccgcgtggt gcgcgacatc ttcaacgacg acttctccaa gatgatcgtg      2040
     gaaggcgacc gcgtgtacga gcgtatcgag gaatacctcg acacgatggc ccccgacctg      2100
     aaagacaagc tcgagaagtg ggatccggcc gaacatgacg gcaaggacgt gttcgacaag      2160
     tggcagatcg actcccagtt gcgtaagggc atggaacgtc aggtctacct gccgtccggc      2220
     ggttcgatcg tcatcgaccg caccgaggcc atgaccacca tcgacgtgaa cacgggccgt      2280
     ttcatcggcc gcggcaagag cctcgaggaa acggtgaccc gttgcaacct cgaagcggcc      2340
     gaagagatcg cgcgacagct tcgtctgcgc gacatcggcg gcatggtgat gatcgacttc      2400
     gtcgacatgg tcatgccggc caacagggat ttggtgctcc gccgactggt ggagtgcctg      2460
     gcgcgcgacc gcaccaagca tcaggtggcc gaagtcacct cgctgggact ggtgcagatg      2520
     acgcgcaagc gcatcggcca gggtctggtg gaggcgttct ccgaggaatg cccgacctgc      2580
     aagggccgcg gcttcatcct ccatgacgaa ccgaccgttt cggcggatta cgacgatccg      2640
     tacgccctga agggcggcga tccgttcgtc aagaccaaca agcatggcca tggcacggac      2700
     gtgcaggtgc cgaagggctc ctcgccggac gtgaaggcca aactcgcgca gatcgcggcg      2760
     gcagccgtgg ccgccaacaa tgcggacctg ggcgaggaag aacaagaaga ataa            2814
//

If you have problems or comments...

PBIL Back to PBIL home page