(data stored in ACNUC30630 zone)

EMBL: AP009256.PE24

AP009256.PE24        Location/Qualifiers
FT   CDS_pept        complement(29202..31958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0024"
FT                   /product="narrowly conserved hypothetical protein"
FT                   /note="Orthologue of BL0604_ Tfu_2554"
FT                   /note="Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38805"
FT                   /db_xref="GOA:A0ZZC2"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC2"
FT                   /protein_id="BAF38805.1"
FT                   /translation="MTTENEQITPADAAIVSSGTGTKGPEERDLPASLKEEMDLCLQIL
FT                   REVLGEFDENLLAKFDEVREHALKASDERFSGILTDTNPDQDDLQKVVDIIDKTDVHEA
FT                   QLLARAFTTYFHLANLCEENYRVSVLHSRENAVDDTQAVDPVNEMTCAYHQLINEMGPA
FT                   RAKELLDQLEFHPVFTAHPTEARRKAVEGKIRRISQLLEAHKLLGGSDKKENSRRLFNE
FT                   IDALFRTSPIALKKPTPVEEADTILDIFDNTLFYTIPQVYRRFDDWVLGDKAGLVPPVC
FT                   PAFFHPGSWIGSDRDGNPNVTAKVSRQVARKFSDHVLGALEIETRRVGKNLTMEAETTP
FT                   PSAELKSLWNHQKEMSERLTDKAALISTKELHRAVMLVMADRLKATIDRDADLMYHSCE
FT                   DYIADLKTVQRSLAEANAKRSAYGPLQDLIWQAETFGFHMVEMEFRQHSVVHSRALEDI
FT                   REHGLHGERGELQPMTHEVLDTFRALGSIQKRNGIKAARRYIISFTKSAQNIKDVYELN
FT                   RLAFSHPEDVPTIDVIPLFEQLEDLQNSVDVLEEMIKIPEVQARLKATGGKMEVMLGYS
FT                   DSSKDAGPTSATLALHSAQERIAKWAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPV
FT                   GSVKCRFKLTEQGEVIFARYGNPVLAIRHVESVAAATLLQSAPSVEKRNTDMTKKYADM
FT                   ASKLDEAAHNRFLDLLNTDGFAPWFSTVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTI
FT                   PWIFSWAQARINLAAWYGLGTACEQFGDLNTLRQAYEEWPLFSTFIDNIEMSLAKTDER
FT                   IAKMYLALGDREDLNKKVLDEMELTRKWVLKIVGDEWPLQHRHVLGQAIRIRSPYVDAL
FT                   SVTQVLALGSLRKRVDKEELTHGQKENYTYLILCTVSGVAAGLQNTG"
     atgacaactg aaaacgaaca gatcacgcct gcggacgcgg ctatcgtctc gtccggcacc        60
     ggcaccaagg gccctgagga gcgtgatctt cccgcatccc tcaaagagga aatggatctg       120
     tgtctgcaga ttcttcgcga ggtgctcggt gagttcgatg aaaacctgct ggccaagttc       180
     gatgaagtgc gcgaacatgc gctgaaggcc agcgacgaac gtttctccgg cattctgacc       240
     gacacgaatc ccgatcagga cgacctgcag aaggttgtcg acatcatcga caagacggac       300
     gtgcatgagg cccagctgtt ggctcgtgcc ttcaccactt acttccatct ggccaatctg       360
     tgcgaggaga actaccgtgt ctccgtgctg cacagccgtg agaacgccgt tgacgacacc       420
     caggccgtcg atccggtgaa cgaaatgacc tgcgcctacc accagctcat caacgagatg       480
     ggtccggcca gagccaagga gctgctcgac cagctcgagt tccatccggt gttcaccgcg       540
     catccgaccg aagcccgccg taaggccgtg gaaggcaaga tccgccgcat ctcccagctg       600
     ctcgaagcgc ataagctgct cggcggctcg gacaagaagg agaactcccg tcgactcttc       660
     aacgagatcg acgcgctgtt ccgtacctcc ccgatcgcgc tgaagaagcc gactccggtt       720
     gaggaagccg acaccattct tgatatcttc gacaacacgc tgttctacac cattccgcag       780
     gtctaccgtc gtttcgacga ctgggtcctc ggagacaagg ccggcctcgt gccgccggtg       840
     tgcccggcgt tcttccatcc gggaagctgg atcggttccg accgtgacgg caacccgaac       900
     gtcaccgcca aggtgagccg tcaggtggcc cgcaagttca gcgaccacgt gctgggcgcg       960
     ctggagatcg agacccgccg cgtcggcaag aacctgacga tggaggccga gaccaccccg      1020
     ccgagcgccg aactcaagtc cctgtggaac caccagaagg aaatgagcga gcgtctgacc      1080
     gacaaggccg cgctgatctc caccaaggag ctgcaccgcg ccgtcatgct ggtcatggca      1140
     gaccgtctga aggccaccat cgaccgcgac gccgacctca tgtaccactc ctgcgaggac      1200
     tacatcgccg atctgaagac cgtgcagcgc tccctcgccg aagccaacgc caagcgttcc      1260
     gcctacggcc cgctgcagga cctcatctgg caggccgaga ccttcggctt ccacatggtc      1320
     gagatggagt tccgtcagca ttccgtcgtg cattcccgcg ctctggagga catccgcgag      1380
     catggcctgc acggtgagcg tggcgagctg cagccgatga cccacgaggt gctcgacacc      1440
     ttccgcgcgc tcggttccat ccagaagcgc aatggcatca aggccgcccg ccgttacatc      1500
     atctccttca ccaagagcgc ccagaacatc aaggacgtgt acgaactgaa ccgtctggcg      1560
     ttctcccacc ccgaggatgt tccgaccatc gatgtgattc cgctgttcga gcagcttgag      1620
     gatctgcaga actcggtgga cgtgcttgag gaaatgatca agatcccgga ggtccaggct      1680
     cgtctgaagg ccaccggcgg caagatggaa gtcatgctcg gctactccga ctcctcgaag      1740
     gacgccggcc cgacctccgc cacccttgcc ctgcactccg cgcaggagcg catcgccaag      1800
     tgggccgaat cgcacgacat cgacctgacc ctgttccatg gccgcggcgg cgccgtcggt      1860
     cgtggcggcg gcccggccaa ccgcgccgtg ctcgcacagc cggtcggctc cgtgaagtgc      1920
     cgtttcaagc tcaccgagca gggcgaggtc atcttcgccc gctacggcaa cccggtgctt      1980
     gcaatccgcc atgtggagtc cgtcgcagcc gcaacgctgc tgcagtccgc tccgagcgtg      2040
     gagaagcgca acacggatat gaccaagaag tacgccgaca tggccagcaa gctcgacgag      2100
     gccgcgcaca accgcttcct cgacctgctg aacaccgacg gcttcgcacc gtggttctcc      2160
     accgtcacgc cgctgaccga aatcggcctg ctgccgatcg gctcccgtcc ggcaaagcgt      2220
     ggtctgggcg ccaagtccct cgacgacctg cgcaccattc cgtggatctt ctcctgggcc      2280
     caggcccgca tcaacctggc cgcatggtac ggcctcggca ccgcgtgcga gcagttcggc      2340
     gacctgaaca ccttgcgtca ggcgtacgag gagtggccgc tgttctccac gttcatcgac      2400
     aacatcgaaa tgtcgctggc caagaccgac gagcgcatcg ccaagatgta cctcgccctc      2460
     ggcgaccgtg aggacctcaa caagaaggtc ctcgacgaga tggagctcac ccgcaagtgg      2520
     gtgctcaaga tcgtcggcga cgaatggccg ctgcagcacc gccacgtgct cggccaggcc      2580
     atccgcatcc gctcgccgta cgtggacgcg ctgtccgtca cccaggtgct cgccctcggc      2640
     tcgctacgca agcgcgtgga caaggaagag ctcacgcacg gccagaagga gaactacacc      2700
     tacctgatcc tgtgcaccgt gtccggtgtc gcagcaggcc tgcagaacac gggctga         2757
//

If you have problems or comments...

PBIL Back to PBIL home page