(data stored in ACNUC30630 zone)

EMBL: AP009256.PE263

AP009256.PE263       Location/Qualifiers
FT   CDS_pept        350021..352213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0263"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0310"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39044"
FT                   /db_xref="GOA:A1A011"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:A1A011"
FT                   /protein_id="BAF39044.1"
FT                   /translation="MNGKRYGRGLIAAFSALVAVVAIILAVFVISGDEADLSYRSVDFD
FT                   ARLQSNGDIRFTEHLDYQLKRREDGNGDTKPWKQLYLTFKLRNQDLTNITDISVTNAST
FT                   GEEYTQTDPQLPSGISDGTWDSTYAGHWYIADTTAGSDSPQPFDPTTDGIDPNGSGEQK
FT                   NIEIGWNIPATVKQSSLKFDVSMTFHDMGTRHSDVTNLMWEMFPENNQVPAGKVTGTVR
FT                   FPKGIASNNSWAWLHTEATSQTSRDADGTLHFTISDLRTNQYVDLVAAFDNTGAAGVER
FT                   TQSGDYLDELKSTEAAKERQWRDRQRLKAQLTVAGWLICLIIGVLCCVLAIRGVLSANR
FT                   EARYQGGIEYWRDPPQVSPAASAYLIDVVDESVGDRSSRAMTATILALVVKKALAVYPG
FT                   PSSLYQGIDLSQANASDLARMIASDPNRAKATASSSTLVIMPAALSHRNTLGLSQSEEA
FT                   CLELLIGISMRVGSPVFDFNQMDTACSDWEEGYQSLNRFKSACGLEFGALGAVKSVNGR
FT                   WLVPSLCLMVIGAIGIFANGASNIAMALCLGVPFICIGVFCMAAGRSEGITERGQQYAG
FT                   ECLGLKRYMEDFSNFSNRGALDLTLWNWYMVYAAAFGISEKVAREFARAYPEVNDPQWL
FT                   DTYGYDSLGYWTYRSQAWNGPINTNGMMPGGMYGGTQFMGGVGDIGSQISSGFASVSST
FT                   ISAAAPSSSSGSGGSFSGGGFGGGGGGGGGGGGGGR"
     atgaacggta aacggtacgg acgcgggcta atcgccgcgt tcagtgcgct ggtggcggtg        60
     gttgccatca tccttgcggt attcgtcata tccggcgacg aggcggacct gagctaccgc       120
     tccgtcgact tcgatgcacg gctccagagc aacggcgaca ttagattcac agagcatctg       180
     gactaccagc tgaagcgtcg cgaggacggc aacggtgaca ccaagccgtg gaaacagctg       240
     tatctgacgt tcaaactgcg caaccaagat ctgacgaaca tcaccgacat ctccgtgacc       300
     aacgcatcca caggcgagga atatacgcag accgatccac aattgccatc cggcatatcc       360
     gacggcacat gggactcgac ctatgccggc cactggtaca tcgccgacac cacggccggt       420
     tccgactcgc cgcagccgtt cgatcccact accgacggca tcgacccgaa tggttccggc       480
     gagcagaaga acatcgagat cggctggaac atccccgcca ccgtcaaaca gagcagcctc       540
     aagttcgatg tgagcatgac gttccatgac atgggcacgc ggcatagcga cgtgacgaat       600
     ctcatgtggg agatgttccc tgaaaacaac caggtgccgg ccggcaaggt caccggcacc       660
     gtgcgtttcc ccaaaggcat cgcctccaac aattcgtggg cgtggttgca taccgaagcc       720
     acctcccaga catcgcgcga tgcggacggc acattgcatt tcaccatcag cgacctgcgc       780
     accaaccaat atgtcgacct cgtcgcggcc ttcgacaaca caggcgctgc cggcgtcgaa       840
     cgtacgcagt ccggcgatta tctcgacgaa ctgaaatcca cggaggccgc caaggaacgg       900
     cagtggcgtg accgacaacg gttgaaggcg cagctcaccg tcgcaggctg gttgatttgt       960
     ctgataatcg gagtgctatg ctgcgtgctg gcgattcgtg gcgtgctgtc ggcgaaccgc      1020
     gaggcccgtt accaaggcgg catcgaatat tggcgcgatc cgccgcaggt cagccctgcg      1080
     gccagcgcgt atctgatcga cgtggtggac gaatccgtag gtgaccgatc atcgcgtgcc      1140
     atgacggcga cgatactggc gttggtggtc aagaaggcgc ttgccgtcta cccggggcca      1200
     tccagcctgt accaaggcat cgacctgagc caagccaacg cctccgacct cgcccgcatg      1260
     attgcttccg atcccaatcg agccaaggcc acggcttcct ccagcactct ggtgatcatg      1320
     ccggccgcgc tttcccatcg caacaccctc ggtctgagcc agtccgagga agcctgtctg      1380
     gaactgctga tcggcatctc catgcgcgtc ggctcgccgg tgttcgactt caaccagatg      1440
     gacacggcct gctccgactg ggaggagggc taccagtccc tgaatcggtt caagagcgcc      1500
     tgtggcctcg aattcggagc gcttggcgcg gtgaagagcg tgaacggacg gtggttggtg      1560
     ccgagcctat gtctgatggt catcggcgct attggtatat tcgccaacgg tgcgagcaat      1620
     atcgcgatgg cgctgtgctt gggcgtgccg ttcatctgta tcggcgtctt ctgcatggcc      1680
     gcgggccgat cggaaggcat caccgaacgc ggccagcagt atgccggcga atgcttggga      1740
     ctcaaacgct atatggaaga tttctccaat ttctccaatc gcggagccct tgatttgacg      1800
     ctatggaact ggtacatggt ctacgcggcg gcgttcggca tctccgagaa ggtagcgagg      1860
     gaattcgccc gcgcctaccc cgaagtcaac gacccgcaat ggcttgacac ctacggttat      1920
     gactccttgg gctattggac ctatcgttcc caggcgtgga acggtccgat caatacgaat      1980
     ggcatgatgc cgggtggtat gtatggcggt acgcaattca tgggcggcgt cggtgacatc      2040
     ggttcgcaga tcagctctgg attcgcttcg gtgagttcca cgatttccgc ggccgcgcct      2100
     tcctcatcct ctggctccgg cggatccttc tccggtggcg gcttcggcgg cggtggcgga      2160
     ggcggcggcg gtggaggcgg cggaggccga tag                                   2193
//

If you have problems or comments...

PBIL Back to PBIL home page